(data stored in ACNUC1104 zone)

EMBL: CP002026.PE25

CP002026.PE25        Location/Qualifiers
FT   CDS_pept        18407..19057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_1878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87362"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87362.1"
FT                   /translation="MAITYPRSLPACGARRVALELFDPVVSAASKRGLVINRTQVVDPL
FT                   WRLRAETHMLRQPAEWIAWGASLGGGLRTFLASDSRYRQPLAYPNAGVPGDVAAGWDGT
FT                   ADVTALGSGGALSLALLPSSYQITAGDRIGLEQGSPLRRGYYMALEDVTASAGGVATVT
FT                   VTPFLHTAIFTAAATARLWRPSAEFVLDPSTWPENPGALPRWSSFSFEAWQTI"
     gtggccatca cctatccgcg cagcctgccg gcctgcggcg cccgtcgggt cgcgctcgaa        60
     ctgttcgacc ccgtggtatc cgccgcgagc aagcgggggc tggtgatcaa ccgcacgcag       120
     gtagtcgatc cgctttggcg gctgcgcgcc gaaacgcaca tgttgcggca gccggcggaa       180
     tggattgctt ggggcgccag tctcggcggt ggcctccgca ccttcctcgc ttccgattcc       240
     cgttaccgcc agccgctggc ctatccgaac gccggagtgc ccggggatgt cgcagccggt       300
     tgggatggaa cggctgatgt caccgcgctc ggttccggcg gcgctctctc gctggcgctg       360
     cttccgtcca gctatcagat cacggccggg gaccggatcg ggctggagca gggatcgccg       420
     ctgcggcgcg gctattacat ggcgctggaa gatgtgaccg cgagcgccgg cggcgtcgcc       480
     acggtaacgg tcaccccatt cctgcacacc gccatcttca ccgcggccgc cacggcgagg       540
     ctatggcgcc cctccgccga gttcgtcctc gatccctcga cgtggcccga aaaccccggc       600
     gctttgccgc ggtggtcttc cttcagcttt gaagcctggc agacgatatg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page