(data stored in ACNUC1104 zone)

EMBL: CP002026.PE251

CP002026.PE251       Location/Qualifiers
FT   CDS_pept        243159..245066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0253"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: azc:AZC_0135 ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87588"
FT                   /db_xref="GOA:D7A1X2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X2"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADH87588.1"
FT                   /translation="MPSLLRRLDLASRGLPALSAALLAFGLLAGPVAAQEGAAPGAAQG
FT                   AAGEWRHGLSLLGTPKYPADFKHFDYVNPDAPKAGLLRLSVDGTFDSLNDIIPRGTPAS
FT                   GLQLIYDTLMSPAYDEVATEYGLLAESVRYPADFSTVTYRLRPEAKWHDGQPVTAEDVV
FT                   WSFEQLTKNNPRQAYYYSHVKKAEVTGEREVTFTFDQAGNRELPQIVGQIRVMPKHWWT
FT                   GKDASGKQRDISQGTLEVPLGSGPYKVKQVVPGRSISFERVPDYWGAGLPVNIGTNNFA
FT                   EQRYEYFRDNVVELEAFKGDQYDFRVETSAKDWATAYDFPAVKQGKVILEEFPDRASGS
FT                   MQAFIPNLRRTKFQDQRVRRALNYALDFDGMNRTLFFGQYKRTSSYFQNTELASSGLPT
FT                   GLELEILNSVKDKVPPSVFTTPYANPPDGGEDVRRANLREAAKLLREAGYQVKGGKLVD
FT                   PQGQPFTIEILLASPAFERVALFYKPTLERLGITVNIRQVDVSQYINRIRARDFDMIVT
FT                   GWGQSLSPGNEQRDFWGSAAADREGSSNYAGIKDSGIDALIERVIYAKDRAELVAATHA
FT                   LDRVLLAHDYVVPTWNYPNTRTARWNRFGRPDKLPEYSFGFPDIWWWDAQKAAQTGGTQ
FT                   "
     atgccgagct tgcttcgccg cctcgatctt gcctctcgcg gccttccggc gctcagcgcc        60
     gcgcttctcg ccttcggcct gctcgccggg ccggtggcgg cacaggaggg cgcggcaccc       120
     ggcgccgcgc agggcgccgc gggtgaatgg cggcacggcc tctccctgct cggcacgccg       180
     aaataccccg ccgacttcaa gcatttcgac tatgtgaacc cggacgcgcc caaggccggc       240
     ctgctgcgcc tctcggtcga cggcaccttc gattcgctca acgacatcat cccgcgcggc       300
     acgccggcgt cggggctgca gctgatctac gacacgctga tgagcccggc ctatgacgag       360
     gtggcgaccg aatacggcct gctggcggag agcgtgcgct accccgccga cttctccacc       420
     gtcacctatc gcctgcgccc cgaagcgaag tggcatgacg gccagccggt gacggccgag       480
     gacgtggtgt ggtccttcga gcagctgacc aagaacaacc cgcgccaggc ctattactac       540
     agccatgtga agaaggccga ggtgaccggc gagcgcgagg tgaccttcac cttcgaccag       600
     gcgggcaatc gcgaattgcc gcagatcgtc ggccagatcc gcgtcatgcc caagcactgg       660
     tggacgggca aggacgccag cggcaagcaa cgcgacatca gccagggcac gctggaagtg       720
     ccgctcggct ccggccccta caaggtcaag caggtggtgc cgggccgctc catctccttc       780
     gagcgggtgc cggactattg gggagcgggc ctgccggtga acatcggcac caacaacttc       840
     gccgagcagc gctacgagta tttccgcgac aacgtcgtgg agctcgaagc cttcaagggc       900
     gaccagtacg atttccgcgt cgagacctcg gccaaggact gggccaccgc ctacgacttc       960
     ccggcggtga agcagggcaa ggtgatcctc gaggagttcc ccgaccgcgc ctccggctcc      1020
     atgcaggcct tcatcccgaa cctgcgccgg acgaagttcc aggaccagcg ggtgcgccgg      1080
     gcgctgaact acgcgctcga cttcgacggc atgaaccgca cgctgttctt cggccagtac      1140
     aagcgcacct ccagctattt ccagaacacc gagctcgcct cctccggcct gccgaccggg      1200
     ctggagctgg aaatcctcaa cagcgtgaag gacaaggtgc cgccgagcgt gttcaccacg      1260
     ccctatgcca acccgccgga cggcggcgag gacgtgcgcc gcgccaatct gcgcgaggcg      1320
     gcgaagctgc tgcgcgaggc cggctaccag gtgaagggcg gcaagctggt ggacccgcag      1380
     ggccagccct tcaccatcga gatcctgctg gcgagcccgg ccttcgagcg cgtcgcgctg      1440
     ttctacaagc cgacgctgga gcggctcggc atcaccgtga acatccgcca ggtcgacgtc      1500
     tcgcaatata tcaaccgcat ccgcgcccgc gacttcgaca tgatcgtcac cggctggggc      1560
     cagtcgctct cgcccggcaa cgagcagcgc gacttctggg gctcggccgc cgccgaccgc      1620
     gagggatcga gcaattatgc cggcatcaag gattccggca tcgacgcgct gatcgagcgg      1680
     gtgatctacg ccaaggaccg cgccgagctg gtcgccgcca cccatgcgct cgaccgcgtg      1740
     ctgctggccc atgactacgt ggtgccgacc tggaactacc ccaacacgcg caccgcgcgc      1800
     tggaaccgct tcggccggcc ggacaagctg ccggaatatt ccttcggctt ccccgacatc      1860
     tggtggtggg acgcccagaa ggcggcgcag accgggggca cgcagtga                   1908
//

If you have problems or comments...

PBIL Back to PBIL home page