(data stored in ACNUC1104 zone)

EMBL: CP002026.PE253

CP002026.PE253       Location/Qualifiers
FT   CDS_pept        247380..248486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0255"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: azc:AZC_0133 peptide ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87590"
FT                   /db_xref="GOA:D7A1X4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87590.1"
FT                   /translation="MLAYIVRRLALMVPTVIGIMLISFAVVQFAPGGPVEKVIAELTGQ
FT                   GASATSRITGGGGDFGGMQQNAPAGDPVSSKYRGAQGLDPAFIKQLEKQFGFDKPAYER
FT                   FGKMLWDYARFDFGRSYFRDISVIDLIAEKMPVSISLGLWMTLITYAISIPLGIAKAVR
FT                   DGSRFDVWTSAVIIVGYAIPSFLFAILLIILFAGGSFFSWFPLRGLTSDNWDQLSLGAK
FT                   ILDYFWHLALPITSMVLGAFATMALLTKNSFLDEIRKQYVITARMKGLSERAVLYRHVF
FT                   RNAMLIIIAGFPGAFVAAFFSGSLLIETIFSLDGLGLLGFESVLNRDYPVVFANLYIFS
FT                   LVGLLINLLSDLTYTWVDPRIDFETRDV"
     atgctcgcct atatcgtccg acgcctcgcg ctgatggtgc cgaccgtcat cggcatcatg        60
     ctgatctcct ttgccgtggt gcagttcgct cctggcggcc cggtggagaa ggtgatcgcc       120
     gaactgaccg ggcagggcgc ctccgccacc tcgcgcatca ccggcggcgg cggcgatttc       180
     ggcggcatgc agcagaacgc cccggcgggc gatccggtct cctcgaaata tcgcggcgcg       240
     caggggttgg accccgcctt catcaagcag ctggagaagc agttcggctt cgacaagccg       300
     gcctatgagc gcttcggcaa gatgctgtgg gactatgccc gcttcgactt cggccgctcc       360
     tatttccgcg acatctcggt catcgacctg atcgccgaga agatgccggt gtcgatctcg       420
     ctcggcctgt ggatgacgct gatcacctac gccatctcca ttccgctggg catcgccaag       480
     gcggtgcgcg acggctcgcg cttcgacgtg tggacctcgg cggtgatcat cgtcggctac       540
     gccataccga gcttcctctt cgccatcctg ctgatcatcc tgttcgccgg cggctcgttc       600
     ttctcctggt tccccttgcg cgggctcacc tccgacaatt gggaccagct ctcgctgggc       660
     gcgaagatcc tcgactattt ctggcacctc gcgctgccca tcacctccat ggtgctcggc       720
     gccttcgcca ccatggcgct gctgaccaag aactcgttcc tcgacgagat ccgcaagcaa       780
     tacgtcatca ccgcgcggat gaaggggctt tcggagcgcg cggtgctcta ccgccacgtc       840
     ttccgcaacg ccatgctgat catcatcgcc ggctttcccg gggcgttcgt cgccgccttc       900
     ttctccggct cgctgctgat cgagaccatc ttctcgctcg acgggctcgg cctgctcggc       960
     ttcgagagcg tgctcaaccg cgactatccg gtggtgttcg ccaacctcta catcttctcg      1020
     ctggtcgggc tgctcatcaa cctgctctcc gacctcacct atacctgggt cgatccgcgc      1080
     atcgacttcg agacgcggga cgtctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page