(data stored in ACNUC1104 zone)

EMBL: CP002026.PE254

CP002026.PE254       Location/Qualifiers
FT   CDS_pept        248488..249666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0256"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xau:Xaut_2635
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87591"
FT                   /db_xref="GOA:D7A1X5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH87591.1"
FT                   /translation="MDAANTTLPSTAPTGASATPAETPRRSRLSPLNQRRLANFRRNRR
FT                   GWWSFWIFSVLFVLSLGAEFIANDKPFLVEYDNAYYFPGLVAYPETTFGGDFETEADYR
FT                   DPYLQKLISEKGGWMVWPPIRYSYSTHNLDLPTPAPSPPTWMLTEAQCAPVVEKLGRTG
FT                   GCDALEWNWLGTDDQGRDVLARLIYGFRLSVLFGLILTIISSIIGVAAGAVQGYFGGWT
FT                   DLIFQRFIEIWTSIPALYLLLIISSILAPGFWVLLGILLLFSWVSLVGLVRAEFLRARN
FT                   FEYVQAARALGVSNLTIMWRHMLPNAMVATLTMLPFIVSSSVMTLTALDFLGFGLPPGS
FT                   PSLGELLAQGKSNVQAPWLGLTGFFTVAIMLSLLIFIGEAVRDAFDPRKTFQ"
     atggacgccg cgaacaccac gctgccgtcg accgcgccga cgggtgcgtc cgccacgccg        60
     gcggagacgc cgcgccgctc gcgcctgtcg ccgctcaacc agcgccgcct cgccaatttc       120
     cgccgcaacc ggcgcggctg gtggagcttc tggatcttct cggtcctgtt cgtgctcagt       180
     ctgggcgccg agttcatcgc caacgacaag ccgttcctgg tcgaatacga caacgcctat       240
     tatttccccg gcctcgtcgc ctaccccgag accaccttcg gcggcgactt cgagaccgag       300
     gcggactacc gcgaccctta cttgcagaag ctgatttccg agaagggcgg ctggatggtc       360
     tggccgccga tccgctactc ctattcgacg cataatctcg acctgccgac gcccgcgccc       420
     tcgccgccga cctggatgct gaccgaggcg cagtgcgcgc cggtggtgga gaagctgggc       480
     cgcaccggcg gctgcgacgc gctggaatgg aactggctcg gcaccgacga ccagggccgc       540
     gacgtgctgg cgcggctgat ctacggcttc cgcctctcgg tgctgttcgg cctgatcctc       600
     acgatcatct cctcgatcat cggcgtggcg gcgggcgcgg tgcagggcta tttcggcggc       660
     tggaccgacc tgatcttcca gcgcttcatc gagatatgga cctcgatccc ggcgctgtac       720
     ctgctgctga tcatctcctc gatcctggca ccgggtttct gggtgctgct cggcatattg       780
     ctgctgttct cctgggtctc gctggtcggg ctggtgcgcg ccgagttcct gcgcgcccgc       840
     aacttcgaat atgtgcaggc cgcgcgggcg ctgggcgtgt cgaacctcac catcatgtgg       900
     cggcacatgc tgcccaacgc gatggtggcc acgctgacca tgctgccctt catcgtgtcg       960
     tcctcggtga tgacgctgac ggccctcgac ttcctcggct tcggcctgcc gcccggctcg      1020
     ccctcgctcg gcgaattgct ggcgcagggc aagtccaacg tgcaggcgcc gtggctcggc      1080
     ctgaccggct tcttcaccgt ggcgatcatg ctgagcctgc tcatcttcat cggcgaagcc      1140
     gtgcgcgacg ccttcgaccc gcggaagacc ttccaatga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page