(data stored in ACNUC1104 zone)

EMBL: CP002026.PE256

CP002026.PE256       Location/Qualifiers
FT   CDS_pept        250398..252029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0259"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bra:BRADO1006 oligopeptide ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87593"
FT                   /db_xref="GOA:D7A1X7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1X7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87593.1"
FT                   /translation="MTSTSPLLSVQDLSVAFAQGARTTLAVDHVSFDLKRGETVALVGE
FT                   SGSGKSVTALSILKLLQYPAASHPSGKVLFKGADLLAMSEREIRGVRGNDITMVFQEPM
FT                   TSLNPLHTVEQQIAEILFLHRGMRGAGARARVIELLTEVGIPEPETRLGSYPHQLSGGQ
FT                   RQRVMIAMALANEPQLLIADEPTTALDVTVQAQILKLLKDLQRRLGMAMLFITHDLGIV
FT                   RKIADHVCVMNKGRIVEAGPVADIFAKPQHPYTRALIAAQPRGNPEPPHPEAPVVLEAK
FT                   DLKVWFPIKAGLMRKTVGHIKAVDGISVEIRRGETLGVVGESGSGKTTLGLALLRLISS
FT                   DGPIVFMGESIDTLGFKQMRSHRHAMQVVFQDPFGSLSPRMSIADIVGEGLRVHQPKLS
FT                   AEEREQRVIDALKDVGLEPESRHRYPHEFSGGQRQRVAIARAIVLEPSFVVLDEPTSAL
FT                   DMIVQAQIVDLLRDLQHKRGLTYLFISHDLRVVAALASRVMVMKGGVVVEEGPAADLFA
FT                   HPKTDYTRALFAAAFNIETAGTAADA"
     atgacctcca cctcccccct cctctccgtc caggacctct ccgtcgcctt cgcgcaggga        60
     gcgcggacga cgctcgcggt ggaccatgtc tccttcgacc tgaagcgcgg ggagacggtg       120
     gcgctggtgg gcgagtccgg ctccggcaag tcagtgacgg cgctctccat cctcaagctg       180
     ctgcaatatc ccgccgccag ccacccctca ggcaaggtgc tgttcaaggg cgcggacctg       240
     ctcgccatgt ccgagcgcga gatacgcggc gtgcgcggca acgacatcac catggtgttc       300
     caggagccga tgacctcgct caatccgctg cacacggtgg agcagcagat cgccgagatc       360
     ctgttcctgc accgcggcat gcggggcgcg ggcgcgcggg cgcgggtgat cgagctgctc       420
     accgaggtcg gcatccccga gccggagacg cggctcggct cctacccgca ccagctctcc       480
     ggcggccagc gccagcgcgt gatgatcgcc atggcgctcg ccaacgagcc gcaattgctc       540
     atcgccgacg agccgaccac ggcgctcgac gtcaccgtgc aggcgcagat cctcaagctc       600
     ttgaaggacc tccagcgccg gctcggcatg gcgatgctgt tcatcaccca cgacctcggc       660
     atcgtgcgca agatcgccga ccatgtctgc gtgatgaaca agggccgcat cgtcgaggcg       720
     gggccggtgg cggacatctt cgccaagccg cagcatccct atacgcgcgc gctcatcgcc       780
     gcccagccgc gcggcaatcc cgagccgccg cacccggaag cgccggtggt gctggaggcg       840
     aaggacctga aggtctggtt cccgatcaag gccggcctga tgcgcaagac cgtcggccat       900
     atcaaggcgg tggacggcat ctcggtggag ataaggcgcg gcgagacgct gggcgtcgtc       960
     ggcgaatccg gctccggcaa gaccacgctc ggcctcgctt tgctgcgcct catctccagc      1020
     gacgggccga tcgtgttcat gggcgagagc atcgacacgc tcggcttcaa gcagatgcgc      1080
     tcgcaccggc acgcgatgca ggtggtgttc caggacccgt tcggctcgct ctcgccgcgc      1140
     atgtcgatcg ccgacatcgt cggcgagggg ctgcgcgtgc atcagcccaa gctctcggcc      1200
     gaggagcgcg agcagcgggt gatcgatgcg ctcaaggatg tcggcttgga gccggagagc      1260
     cggcaccgct acccgcacga attctccggc ggccagcgcc agcgtgtcgc catcgcccgc      1320
     gccatcgtgc tggagccctc cttcgtggtg ctggacgagc cgaccagcgc gctggacatg      1380
     atcgtgcagg cgcagatcgt cgacctgctg cgcgacctcc agcacaagcg cgggctgacc      1440
     tatctcttca tcagccacga tctgcgcgtc gtcgccgcgc ttgcctcgcg ggtcatggtg      1500
     atgaagggcg gcgtggtggt ggaggaaggc cccgccgccg acctcttcgc ccacccgaag      1560
     accgactaca cgcgggcgct gttcgccgcc gccttcaaca tcgagaccgc cggtaccgcg      1620
     gcggacgcct ag                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page