(data stored in ACNUC1104 zone)

EMBL: CP002026.PE263

CP002026.PE263       Location/Qualifiers
FT   CDS_pept        complement(257118..257933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0266"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   azc:AZC_1754 enoyl-acyl carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87600"
FT                   /db_xref="GOA:D7A1Y4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87600.1"
FT                   /translation="MASGGLMSGKRGLVMGVANNRSIAWGIAKAAHAQGAKLAFTYQGE
FT                   PLKKRVEPLAAELDATLVGHCDVTDPATIDAVFAETERQLGGLDFLVHAIAFSDKNELD
FT                   GRYVDTTAENFSKTMLISCYSFTAVAQRAEKLMTDGGSMLTLTYYGAEKWMPHYNVMGV
FT                   AKAALEASVRYLAADLGPKNIRVNAISAGPIKTLAASGIGDFRYILKWNELNAPLRRTV
FT                   TIDEVGDTGMYLLSDLGRAVTGEIHHVDAGYHIVGMKNPEAPDLTLERD"
     atggcatcgg gcggattgat gagcggaaag cgcggcctgg tgatgggagt ggcgaacaac        60
     cgctccatcg cctggggcat cgccaaggcc gcccatgcgc agggcgcgaa gctcgccttc       120
     acctatcagg gcgagccgct gaagaagcgg gtggagccgc tggccgccga gctcgacgcc       180
     accctcgtcg gccattgcga cgtcaccgat cccgcgacca tcgacgccgt cttcgccgag       240
     accgagcgcc agctcggcgg gctcgacttc ctcgtccacg ccatcgcctt ctccgacaag       300
     aacgagctcg acgggcgcta tgtcgacacc acggcggaga acttcagcaa gaccatgctg       360
     atctcctgct acagcttcac cgccgtcgcc cagcgcgccg agaagctgat gaccgacggc       420
     ggctcgatgc tgaccctgac ctattacggc gccgagaagt ggatgccgca ctacaacgtc       480
     atgggcgtcg ccaaggcggc gctcgaggcg agcgtgcgct acctcgccgc cgacctcggc       540
     ccgaagaaca tccgcgtcaa cgccatctcc gccgggccga tcaagacgct ggccgcctcg       600
     ggcatcggcg acttccgcta catcctcaag tggaacgagc tgaacgcccc gctgcgccgc       660
     accgtcacca tcgacgaagt cggcgacacc ggcatgtacc tgctctccga tctcgggcgc       720
     gccgtcaccg gcgagatcca ccatgtcgat gccggctacc acatcgtcgg catgaagaac       780
     cccgaagcgc ccgacctcac cctcgagcgc gactga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page