(data stored in ACNUC1104 zone)

EMBL: CP002026.PE264

CP002026.PE264       Location/Qualifiers
FT   CDS_pept        complement(258057..259028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0267"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="KEGG: azc:AZC_1199 heat shock protein; PFAM:
FT                   chaperone DnaJ domain protein; heat shock protein DnaJ
FT                   domain protein; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87601"
FT                   /db_xref="GOA:D7A1Y5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y5"
FT                   /inference="protein motif:PFAM:PF01556"
FT                   /protein_id="ADH87601.1"
FT                   /translation="MRDPYDILGVARNADQNEIKRAFRKHAKKLHPDANKDDPKAQERF
FT                   AELNSAHEILSDPEKRGQYDRGEIDAEGKPRGFEGFPGGGAGGFNRGGFQRGPHGETIF
FT                   ESFSFGPEGARRSGHGPHDAGGFDDVIADILGGLGGRGRGRARAGGQQEMPRGGDVDIS
FT                   VPVPLERVVEGGPVKVHLPNGRTVEVKIPPKVTEGHRMRLKGQGEPSPFGGAPGDAYVV
FT                   VAYAPHRHFKVEGADLRTDVSLPLADAVLGGKLRVPTLSGEVELSVPAWTQSGRTFRLR
FT                   GKGLPKGDDAAGDLFATVRITLPETPDAELEELMRRRRDGAA"
     atgcgcgatc cctatgacat cctcggcgtc gcccgcaacg ccgaccagaa cgagatcaag        60
     cgtgctttcc gcaagcacgc caagaagctg cacccggacg ccaacaagga cgatccgaag       120
     gcgcaggagc gttttgccga actgaacagc gcgcacgaga tactctccga tccggagaag       180
     cgcggccagt acgaccgcgg cgagatcgac gccgagggca agccgcgcgg cttcgagggc       240
     tttccgggcg gcggcgccgg cgggttcaac cgcggcggct tccagcgtgg cccccatggc       300
     gagacgatct tcgaaagctt ctccttcggc ccggagggtg cacgccgctc cggccacggc       360
     ccgcacgacg ccggcggctt cgacgacgtg atcgccgaca ttctcggcgg gctcggcggc       420
     cggggccgcg ggcgcgcccg tgctggcggc cagcaggaga tgccgcgcgg cggcgacgtc       480
     gacatctccg tgccggtgcc gctggagcgc gtggtcgaag gcggcccggt caaggtgcac       540
     ctgccgaacg gacgcacggt cgaggtgaag atcccgccca aggtcactga gggccaccgc       600
     atgcggctga agggccaggg cgagccgagc cccttcggcg gcgcgccggg cgacgcctat       660
     gtcgtcgtcg cctatgcgcc gcaccgccac ttcaaggtcg agggcgcgga cctgcgcacc       720
     gacgtctcgc tgccgctggc cgacgccgtg ctcggcggca agctgcgcgt gcccacgctc       780
     tccggcgagg tcgagctctc cgtgccggcc tggacccagt cgggccgcac cttccgcctg       840
     cgcggcaagg gactgcccaa gggcgacgat gccgccggcg acctcttcgc cacggtgcga       900
     atcacgctgc ccgagacgcc cgatgcggag ctcgaggagc tgatgcgccg ccggcgcgac       960
     ggcgcggcat aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page