(data stored in ACNUC1104 zone)

EMBL: CP002026.PE265

CP002026.PE265       Location/Qualifiers
FT   CDS_pept        complement(259125..259628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_1198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87602"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87602.1"
FT                   /translation="MDTFHRRRATAAQVASRGGSSYKRDTSFRTAALWTTLVGALAMAG
FT                   CSSAPPLDMQATGSISPRRAAAYQREPVPQGVAPDDWAAARLALAEALREDSKAPSVPW
FT                   ENYASATRGTVTPLASSASGRGACRDFLMSFVRAAGEEWLQGEACRNERGWWKVDEARL
FT                   LARG"
     atggacacgt tccacaggcg gcgggcgacg gcggcgcagg tcgcgtcgcg cggcggctcc        60
     tcatataagc gcgacacgtc cttccgcaca gccgccctat ggacgacttt ggtcggcgcg       120
     ctcgccatgg ccggctgttc gagcgccccg ccgctcgaca tgcaggccac cggctccatc       180
     tcgccgcgcc gcgccgccgc ctatcagcgc gagccggtgc cgcagggcgt ggcgccggac       240
     gactgggccg ccgcgcgcct cgcgctcgcc gaggcgctgc gcgaggattc caaggcgccg       300
     agcgtgccgt gggagaacta tgccagcgcc acgcgcggca ccgtcacccc gctcgcctcc       360
     tcggcctcgg gccgcggcgc ctgccgcgat ttcctgatga gcttcgtgcg cgccgccggc       420
     gaggaatggc tgcagggcga ggcctgccgc aacgagcgcg gctggtggaa ggtcgacgag       480
     gcgcggctgc tggccagagg ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page