(data stored in ACNUC1104 zone)

EMBL: CP002026.PE266

CP002026.PE266       Location/Qualifiers
FT   CDS_pept        259664..260290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0269"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; KEGG:
FT                   azc:AZC_1197 pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   Pyridoxine 5'-phosphate oxidase, dimerisation-like"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87603"
FT                   /db_xref="GOA:D7A1Y7"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y7"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ADH87603.1"
FT                   /translation="MEASEELISGDFTAATEPFRLFEEWFAEAKEKEPRDPNAMALATV
FT                   DADGLPDVRMVLLNQRDERGFVFFTNTGSAKGCELAAVPKAAVVFHWKSMNRQIRVRGP
FT                   VEVVSDEEADAYFLTRPRLSQIGAWASVQSRPLEGRFALEAAVAKYTAQYALGSVPRPP
FT                   HWTGFRIRPVQIEFWHDRPFRLHDRIVFRRDSAEATVWNKTRLYP"
     atggaagcgt ctgaagagtt aatatccggt gatttcaccg ccgccacgga gcctttccgg        60
     ctgttcgagg agtggttcgc cgaggccaag gagaaggagc cgcgggatcc caacgccatg       120
     gcgctggcga ccgtcgacgc cgacgggctg ccggatgtgc gcatggtgct gttgaaccag       180
     cgcgacgagc gcggcttcgt gttcttcacc aataccggca gcgccaaggg ctgcgagctc       240
     gccgccgtgc cgaaggcggc ggtggtgttc cactggaagt cgatgaaccg ccagatccgc       300
     gtgcgcggcc cggtggaggt ggtgagcgac gaggaggccg acgcctattt cctcacccgg       360
     ccgcgcctgt cgcagatcgg cgcctgggcg agcgtgcagt cgcgcccgct ggaggggcgc       420
     ttcgcgctgg aggcggcggt ggcgaaatac accgcgcaat atgcgctggg cagcgtgccg       480
     cgcccgccgc actggaccgg cttccgcatc cggccggtgc agatcgagtt ctggcacgac       540
     cgcccgttcc gcctgcatga ccgcatcgtg ttccgcaggg acagcgccga ggcgactgtc       600
     tggaacaaga caagacttta cccctga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page