(data stored in ACNUC1104 zone)

EMBL: CP002026.PE267

CP002026.PE267       Location/Qualifiers
FT   CDS_pept        260340..261089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0270"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mno:Mnod_1067 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87604"
FT                   /db_xref="GOA:D7A1Y8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADH87604.1"
FT                   /translation="MTKGTNQPRRTMLLTGASRGIGHATVKRFSAAGWRVITCSRHAFP
FT                   ENCPWEMGPEDHIQVDLSDPADTLRAVDEIKSRLPDGELHALVNNAGISPKGPGGSRLG
FT                   TLNTPEEDWRRVFQVNFFAPILLARGLLEELKRTHGAVVNVTSIAGSRVHPFAGAAYAT
FT                   SKAALAGLTREMAADFGPLGVRVNAIAPGEIDTSILSPGTEKIVEQIPMQRLGTPDEVA
FT                   KIIYVLCTDTSSYLNGAEIHINGGQHV"
     atgaccaagg gtaccaacca gcctcgccgc accatgctgc tcaccggcgc ctcgcgcggg        60
     atcgggcacg ccaccgtcaa gcgcttctcg gccgcgggat ggcgggtgat cacctgctcg       120
     cgccatgcct tcccggagaa ttgtccgtgg gagatggggc cggaggacca tatccaggtc       180
     gacctctccg acccggccga cacgctccgc gcggtggacg agatcaagag ccggctgccg       240
     gacggcgaac tgcacgcgct ggtcaacaat gccggcatct cgcccaaggg ccccggcggg       300
     tcccgcctcg gcacgctcaa cacgccggag gaggactggc ggcgggtgtt ccaggtgaac       360
     ttcttcgccc cgatcctcct ggcgcgcggc ctgctggagg agctcaagcg cacccatggc       420
     gcggtggtga acgtcacctc cattgccggc tcgcgggtgc atccctttgc cggcgcggcc       480
     tatgccacct cgaaggcggc gctggccggg ctgacccgcg agatggcggc cgatttcggc       540
     ccgctcggcg tgcgggtgaa cgccatcgcg ccgggcgaga tcgacacctc gatcctgtcg       600
     ccgggcaccg agaagatcgt cgagcagatc ccgatgcagc gcctcggcac gcccgacgag       660
     gtggcgaaga tcatctacgt gctgtgcacg gacacctcgt cctatctgaa cggggcggag       720
     atccacatca acggcggcca gcacgtgtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page