(data stored in ACNUC1104 zone)

EMBL: CP002026.PE268

CP002026.PE268       Location/Qualifiers
FT   CDS_pept        complement(261299..262276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0271"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: oca:OCAR_6914 Mg2+ transporter protein, CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87605"
FT                   /db_xref="GOA:D7A1Y9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Y9"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ADH87605.1"
FT                   /translation="MITAHCVRGGTLVSVHLGAGEALPPDAVWIDLNQPADGEDRLVEA
FT                   AIGISVPTRAEMLEIEPSSRLRVENGARYMTGSIVCNSDSDRPTLAQVSFILAKGKLTT
FT                   VRYDEPKPFRLVLAKLDRDCPQTMKGDRLLLELLDTIVDRAADIIETLSEDIDGLSRRI
FT                   FERESSSNGGSQRFRVILKLLGRRADLASKVRESLVSMGRLVTFLSTEGEAERFDKEQR
FT                   TWLKSMQRDTASLNDHVSYLGNKIIFLLDATLGMVSIEQNNIIKIFAVLSVVLMPPTLI
FT                   ASIYGMNFQHMPELGERFGYPVALIAMLAAAVVPYWFFKWKKWL"
     atgatcaccg cccattgcgt gcgcggcggc acgctcgtgt ccgttcacct cggcgcgggc        60
     gaggccctgc ctcccgacgc ggtgtggatc gacctcaacc agccggccga cggcgaggac       120
     cgcctcgtcg aggcggcgat cggcatctcg gtgccgaccc gggcggagat gctggagatc       180
     gagccgtcga gccgcctgcg ggtggagaac ggcgcccgct acatgaccgg ctccatcgtc       240
     tgcaacagcg acagcgatcg cccgacgctg gcccaggtgt cgttcatcct cgccaagggc       300
     aagctcacca ccgtgcgcta tgacgagccc aagcccttcc gcctcgtcct cgccaagctc       360
     gaccgcgact gcccgcagac gatgaagggc gaccggctgc tgctggaact gctcgacacc       420
     atcgtcgacc gcgccgccga catcatcgag acgctgtcgg aggacataga cggcctgtcg       480
     cggcgcatct tcgagcgcga atcctcctcg aacggcggca gccagcgctt ccgggtgatc       540
     ctgaagctgc tcggccgccg cgccgacctc gcctccaagg tgcgcgagag cctggtctcg       600
     atgggccgcc tcgtcacctt cctgtccacg gaaggcgagg ccgagcgctt cgacaaggag       660
     cagcggacct ggctgaagag catgcagcga gacaccgcct cgctgaacga ccatgtcagc       720
     tatctcggca acaagatcat cttcctgctc gacgccacgc tcggcatggt cagcatcgag       780
     cagaacaaca tcatcaagat cttcgccgtg ctgtcggtgg tgctgatgcc gccgaccctg       840
     atcgcctcga tctacggcat gaacttccag cacatgcccg agctcggcga gcgcttcggc       900
     tatcccgtag ccctcatcgc catgctggcg gcggcggtcg tgccctactg gttcttcaag       960
     tggaagaaat ggctgtag                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page