(data stored in ACNUC1104 zone)

EMBL: CP002026.PE269

CP002026.PE269       Location/Qualifiers
FT   CDS_pept        complement(262468..262692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sru:SRU_0693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87606"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z0"
FT                   /inference="similar to AA sequence:KEGG:SRU_0693"
FT                   /protein_id="ADH87606.1"
FT                   /translation="MSSEDQPAPEAQPSQRWEASQQNAHWREIGLPALAAAAPYNAAKQ
FT                   TVSDAPGTGAARTDEAKIVTIRDVEYFAA"
     atgtccagtg aagaccaacc ggcgcccgag gcgcagccta gccagcgctg ggaagcgtcc        60
     cagcaaaacg cgcattggcg cgagatcggc ctcccggcgc ttgccgccgc ggcgccctac       120
     aacgctgcca agcagacggt atccgatgcc cccggtacgg gcgcggcgcg gaccgacgag       180
     gcaaagatcg tcacgatccg agacgtagaa tatttcgcgg cctga                       225
//

If you have problems or comments...

PBIL Back to PBIL home page