(data stored in ACNUC1104 zone)

EMBL: CP002026.PE273

CP002026.PE273       Location/Qualifiers
FT   CDS_pept        266670..267395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0276"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: xau:Xaut_2473 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87610"
FT                   /db_xref="GOA:D7A1Z4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z4"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADH87610.1"
FT                   /translation="MNAPRAILFDKDGTLVDFDRTWGPAAGAVMRRLAGADEAALTQLY
FT                   AASHFLPAEDRFLQSSPLIAGSSRQYGPLWAQILDVPATMDFFGEIDRLFREEGGRYLT
FT                   PIGSPAQTLGRLHALGLPLGIATNDAEPNARLQATQLGLDGLLSAVYGYDSGYGSKPAP
FT                   GMVEAFSRLTGLAPADIALVGDTRHDLHTARNAGAIAVLVRCGPGPVDDFAHEADLVVD
FT                   TVEDLADMILRAAPAEAAR"
     gtgaacgcgc cacgcgccat tctgttcgac aaggacggta ccttggtcga tttcgaccgt        60
     acctggggac ccgccgcagg tgccgtgatg cgccgtctcg ccggagcgga cgaagcggcg       120
     ctgacccagc tttacgcagc cagccatttt ctgccagcgg aagatcgctt cctgcagagc       180
     tcgccgctca tcgccggctc ctcgcggcaa tatggcccgc tctgggcgca gatcctcgac       240
     gtgccggcga cgatggactt cttcggcgag atcgaccggc tctttcgcga ggaaggcggg       300
     cgctacctca cccccatcgg cagccccgcg cagacgctcg gccggctgca cgcgctcggc       360
     ctgccgctcg gcatcgccac caacgacgcc gagcccaatg cccgcctgca ggcgacccag       420
     ctcggcctcg acgggctgct cagcgccgtc tacggctatg attccggcta cggctccaag       480
     ccggcgcccg gcatggtgga ggcgttcagc cgcctgaccg gcctcgcccc ggccgacatc       540
     gccctcgtcg gcgatacccg gcacgatctg cacaccgccc gcaatgccgg cgccatcgcg       600
     gtgctggtgc gctgcggccc cggcccggtg gacgatttcg cccacgaggc cgacctcgtg       660
     gtcgacacgg tggaggacct cgccgacatg atcctgcgcg ccgctccggc ggaggcggcc       720
     cgatga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page