(data stored in ACNUC1104 zone)

EMBL: CP002026.PE274

CP002026.PE274       Location/Qualifiers
FT   CDS_pept        267392..268177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0277"
FT                   /product="protein of unknown function DUF1499"
FT                   /note="PFAM: protein of unknown function DUF1499; KEGG:
FT                   azc:AZC_1485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87611"
FT                   /db_xref="GOA:D7A1Z5"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z5"
FT                   /inference="protein motif:PFAM:PF07386"
FT                   /protein_id="ADH87611.1"
FT                   /translation="MIRRRLYIEERMSRLAVWSLRTAIFAFPVTLIGAALYATETLDFR
FT                   SAAYTVLAGVGVAVLALLLAFAGFVVIWNEGLKGLGRVIGAAALALLLITPTATLAALA
FT                   VGLKTLPDVTSDTEDPPEFVTLGTVRSRASTGLAYPGGKLADDQLDIYPGIKPITFDAP
FT                   PDEIFRVLMNMVTRHKWLVVDSVPPRGERDGRIEAVARSLPFGLRDDMVIRVRRTPTGS
FT                   IVDMRSVARSGNRDFGSNARRIDQLFDELADQQGRPRRQ"
     atgatccgcc gccgcctcta catcgaggag cgcatgtcgc ggctcgccgt ctggagcctg        60
     cgcacggcga tcttcgcctt cccggtcacc ctcatcggcg ccgcgctcta cgccaccgag       120
     acgctcgatt tccgcagcgc ggcctatacc gtgctggccg gcgtcggggt ggcggtgctg       180
     gcgctgctgc tcgccttcgc cggtttcgtc gtcatctgga acgaggggct gaagggcctc       240
     ggccgggtca tcggcgcggc tgcgctggcg ctgctgctga tcaccccgac cgcgacgctc       300
     gccgcgctcg ccgtcggcct caagaccctg ccggacgtga ccagcgacac cgaggacccg       360
     ccggaattcg tcacgctggg cacggtgcgc tcgcgtgcct ccaccggcct cgcctatccc       420
     ggcggcaagc tcgccgacga ccagctcgac atctatcccg gcatcaagcc gatcaccttc       480
     gacgccccgc cggacgagat cttccgcgtg ctgatgaaca tggtgacgcg gcataaatgg       540
     ctcgtcgtcg attcggtgcc gccgcgcggc gagcgcgacg ggcggatcga ggcggtggca       600
     cgcagcctgc ccttcggcct gcgcgacgac atggtgatcc gggtccggcg cacgccgacc       660
     ggctccatcg tcgacatgcg ctcggtggcg cgcagcggca accgcgactt cggctccaac       720
     gcaaggcgca tcgaccagct cttcgacgag ctcgccgacc agcagggccg cccgcgccgg       780
     cagtaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page