(data stored in ACNUC1104 zone)

EMBL: CP002026.PE275

CP002026.PE275       Location/Qualifiers
FT   CDS_pept        complement(268180..269091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0278"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /note="KEGG: azc:AZC_1482 metallo-beta-lactamase
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87612"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z6"
FT                   /inference="similar to AA sequence:KEGG:AZC_1482"
FT                   /protein_id="ADH87612.1"
FT                   /translation="MAEDIPFERRFDAVPGVADEVAPGVRRVLAPNPGPFTFTGTCSYI
FT                   VGRGEVAIIDPGPDDASHVSALLAAIHGEKVTHIFLTHTHRDHSGALDALKEATGAPAY
FT                   AEGPHRPARELHAGETNVLDAAGDRSFLPDVALADGARVEGAGWTIDALATPGHAANHM
FT                   AYVLEGAGLIFVGDHVMGWSTTIVAPPDGSMSDYMDSLRRLGERPEQLYLPGHGGAIPQ
FT                   GPAFVERYLRHRQAREAAIVRALERGPLAIPEIVRAIYIGLDPRLAGAAGLSTLAHLED
FT                   LVGRGEALTEGPAALEGVFRLP"
     atggcagagg acatcccctt cgagcggcgc ttcgacgccg tgcccggcgt cgccgatgaa        60
     gtggcgcccg gcgtgcgccg cgtgctggcg cccaatcccg gcccgttcac cttcaccggc       120
     acctgcagct acatcgtcgg ccgcggcgag gtggcgatca tcgatcccgg cccggacgat       180
     gcctcccacg tctccgccct gctcgccgcc atccacggcg agaaggtgac gcacatcttc       240
     ctcacccaca cccaccgcga ccacagcggc gcgctcgacg cgctgaagga ggcgaccggc       300
     gcccccgcct atgccgaggg cccgcaccgg ccggcgcgcg aactgcatgc gggcgagacc       360
     aacgtgctgg acgccgcggg cgaccgctcc ttcctgccgg acgtcgcttt ggccgacggc       420
     gcgcgggtgg aaggcgcggg ctggacgatc gacgccctcg ccacccccgg ccacgccgcc       480
     aaccacatgg cctatgtgct ggaaggcgcc ggtctcatct tcgtcggcga ccatgtgatg       540
     ggatggtcca ccaccatcgt cgcgccgccg gacggctcga tgagcgacta catggattcg       600
     ctgcgccggc tcggcgagcg gccggaacag ctctatctgc ccggccatgg tggcgcgatc       660
     ccgcaggggc cggccttcgt cgagcgctat ctgcgccatc gccaggcgcg cgaggccgcc       720
     atcgtgcggg cgctggagcg cgggccgctg gcgatcccgg agatcgtgcg ggcgatctat       780
     atcggcctcg acccgcgcct cgccggtgcc gcggggctct ccaccctcgc ccatctggag       840
     gacctggtcg ggcgcggcga ggcgctcacc gaggggccgg cggcgctcga aggcgttttc       900
     cgcttgccgt aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page