(data stored in ACNUC1104 zone)

EMBL: CP002026.PE277

CP002026.PE277       Location/Qualifiers
FT   CDS_pept        270050..270595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0280"
FT                   /product="protein of unknown function DUF892"
FT                   /note="PFAM: protein of unknown function DUF892; KEGG:
FT                   gdj:Gdia_1370 protein of unknown function DUF892"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87614"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010287"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z8"
FT                   /inference="protein motif:PFAM:PF05974"
FT                   /protein_id="ADH87614.1"
FT                   /translation="MGLFSKDIKSLDDLLRQSLGELLYTERRIAKALPGLAAKVSDPLL
FT                   RRELERARMASEDHLARIEEVFLRHDAAPRSIECPAIDGIFISAEELNEEIDDFYVLDT
FT                   AIAAAMQAVATYSAARYMTAAAWLRQLGQPECARLLHANLVARQRAADALCALAEQRLN
FT                   ARARGRSDDRPSGVALAG"
     gtgggactgt tctccaagga catcaagtcg ctcgacgatc tcctccggca gagcctcggc        60
     gagctgctct acaccgaacg gcggatcgcc aaggcgctgc cgggactggc cgccaaggtc       120
     tccgatccgc tgctccgacg ggaactcgag cgagcgagga tggcgagcga ggatcacctc       180
     gcgcgcatcg aggaggtgtt cctccggcac gatgcggcgc cccgttccat cgaatgtccg       240
     gcgatcgacg gcattttcat cagcgccgag gaattgaacg aagagatcga cgatttctac       300
     gtgctcgaca ctgccatcgc tgccgccatg caggcggtcg cgacctatag cgccgcccgc       360
     tacatgacgg cggccgcctg gctgcgccag cttggccagc cggaatgtgc ccgcctgctg       420
     cacgccaatc tggtcgcgcg ccagcgcgcg gcggatgcgc tctgcgcgct tgccgagcag       480
     cggctgaacg cccgtgcccg cggacgcagc gacgaccggc cctccggcgt ggccctggcc       540
     ggctag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page