(data stored in ACNUC1104 zone)

EMBL: CP002026.PE278

CP002026.PE278       Location/Qualifiers
FT   CDS_pept        complement(270592..271512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rce:RC1_2166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87615"
FT                   /db_xref="InterPro:IPR022025"
FT                   /db_xref="UniProtKB/TrEMBL:D7A1Z9"
FT                   /inference="similar to AA sequence:KEGG:RC1_2166"
FT                   /protein_id="ADH87615.1"
FT                   /translation="MAVRVSTLLPATAFLPLPVPLAVSGQPRRVGVEVEFTRLSERRAA
FT                   ERIAREMGGTLREEDPHAFHIIGSRLGDLCVELDMRHAHPHRDGHPMPRLRPHAGLIGA
FT                   ALRPFVPRELVTGPILPGDLGEMDDLVRALREEGAGGDGATVLGSLGLHFNIVPASLEP
FT                   SALLAMLRAFLLSEPRLRAQGLTGLSRLHAPPPYPQDYVDKVLGPGYRPDLEALCDDYV
FT                   GANPTRSRALDLLPLFLELFPERVAPRISGKVKPRAALHYRLPVARVGRPGWSLAEDWN
FT                   RWVEVERLAADPSRLAAAVARHRPV"
     atggccgtgc gcgtgagtac cctcctgccg gcaaccgcct tccttcccct gcccgtcccg        60
     ctcgccgtca gtgggcagcc gcgccgcgtc ggcgtcgagg tcgagttcac ccgcctctcc       120
     gagcggcggg cggccgagcg catcgcgcgc gagatgggcg gcacgctgcg cgaggaggac       180
     ccgcacgcct tccacataat cggctcgcgg ctgggcgacc tgtgcgtcga gctcgacatg       240
     cgccacgccc acccccatcg cgacggccat cccatgccgc ggctgcgccc acatgccggc       300
     ctcatcggcg cggcgctgcg ccccttcgtg ccgcgcgagc tggtgaccgg gccgatcctg       360
     ccgggcgatc tcggggagat ggacgacctg gtgcgcgccc tgcgcgagga aggcgccggc       420
     ggggacggcg ccaccgtcct cggctcgctg gggctgcatt tcaacatcgt gccggcctcg       480
     ctggagccgt cggcgctgct ggcgatgctg cgggccttcc tgctctcgga accgcgcctg       540
     cgggcgcagg gcctgaccgg cctctcgcgg ctgcacgcgc cgccgcccta cccgcaggac       600
     tatgtggata aggtgctcgg tcccggctat cggccggatc tggaggcgct gtgcgacgac       660
     tatgtcggcg ccaacccgac gcgcagccgc gccctcgacc tcctgccgct gttcctcgaa       720
     ctgtttcccg agcgcgtcgc cccgcgcatc agcggcaagg tgaagccgcg cgcggcgctg       780
     cattaccggc tgccggtggc gcgcgtcggc cgccccggct ggagcctcgc ggaagactgg       840
     aatcgctggg tcgaggtgga gaggcttgcg gccgatcctt cacggctggc ggcggcggtc       900
     gcgcgccacc ggcccgtcta g                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page