(data stored in ACNUC1104 zone)

EMBL: CP002026.PE279

CP002026.PE279       Location/Qualifiers
FT   CDS_pept        272061..272798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0282"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG: bja:blr5577
FT                   hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87616"
FT                   /db_xref="GOA:D7A200"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:D7A200"
FT                   /inference="protein motif:PFAM:PF01177"
FT                   /protein_id="ADH87616.1"
FT                   /translation="MRIHLVNPNTTRSMTETIAAAARVVAAPGTQIMAATSAMGPASIE
FT                   GHYDDALALPGLLAAIAEAEAAGVDAHIIACFDDTGLEAARTLARAPVVGIGEAGFHMA
FT                   SLLAHRFAVVTTLSRSIPVIEGNLLRYGLDRRCAAVRASEVAVLELEDPASGARARISE
FT                   EIGRALREDRAEAIVLGCAGMADLARALGEEHGVPVIDGVASAVALAEGLVRAGLTTSK
FT                   TGAYAPPRPKPYAGRLADFAPKG"
     ttgcgcatcc atctcgtcaa tcccaacacc acgcggtcga tgaccgagac catcgccgcc        60
     gccgcacgcg tcgtcgcggc gccgggcacg cagataatgg cggcgacctc cgccatgggg       120
     ccggcctcga tcgaggggca ttatgacgat gcgctggcgc tgcccggcct gctcgccgcc       180
     atcgccgagg ccgaggcggc gggggtggac gcgcatatca tcgcctgctt cgacgatacc       240
     gggctggagg ctgcgcgcac gctcgccagg gcgccggtgg tcggcatcgg cgaggccggc       300
     ttccacatgg cgagccttct cgcccaccgc tttgcggtgg tgacgacgct gtcgcgttcc       360
     attcccgtca tcgagggcaa tctcctgcgc tacggtctcg accgccgctg cgccgccgtg       420
     cgcgcctcgg aagtggcggt gctggaactg gaggacccgg cttccggcgc ccgcgcccgc       480
     atctcggagg agatcggccg cgccctgcgc gaggaccggg cggaggcgat cgtgctcggc       540
     tgcgccggca tggcggatct ggcccgcgcc ctgggcgagg agcacggcgt gccggtgatc       600
     gacggggtgg cgagcgcggt ggcgctggcg gaagggctgg tcagggccgg gctgacgacc       660
     tcgaagaccg gcgcctatgc gccgccgcgg ccgaagccct atgccggccg cctcgccgat       720
     ttcgccccga agggatag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page