(data stored in ACNUC1104 zone)

EMBL: CP002026.PE28

CP002026.PE28        Location/Qualifiers
FT   CDS_pept        20105..22708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_2085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87365"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87365.1"
FT                   /translation="MPFIAPIIGAVGAAIGAVGSFVGSLGIVGQALLGIGASVLSSVIQ
FT                   KETAGKAEKQPGGVQFERQYGGDVPRQVACGLVGIAGHDTYVNTFGPANGILQQIYTLS
FT                   DFPCHGLSRVAINGKWVTLGPVGEDGMRKVTSGEYADLIRVQFVDGTQTAALAGLVNSA
FT                   NPSDRWTANHIGAGVAYVYIALAFTEPLTNFPDFFFEFYGARFYDWRKDSTVGGSGGHR
FT                   WGNYATYEFTENPVVIEYNYRRGIAWNGDMFCGMAMPAADLPLAKWTAAANICDETTDY
FT                   GTRYRCSIMLDCTAMHGENITSLQLSCGAKKVDAVDGSWPLVGHDQAVVATITDDDLIV
FT                   GVRGRWTARRSMSDLVNRVYGTFPNPDNLWSPADYELQGGGALVVLDRRDRDVPLDFPM
FT                   VRVPGQAAQLARIYLEENRYEATGDEVWRPRFQVLEPGDWIRRIGRTHGDRIYQITGLS
FT                   LASHDADGPRNVSVSLQEVDGAIYDGITAPPIVVPMPPGAPVLLNEVQDFDLAPVTVLG
FT                   DDGRLLPAIRASWASITDVTVAYVDLQYWPTAQPTSVFTKRVPATETITVLAEGVVRAT
FT                   EYTVRTRLVTQPPRVTVWSAGETVTTTAIPDTEIDVYLANIKGDAYDALRRMREDLTAN
FT                   VQRMDMFVRDTSVGLGRQVTSTSVATRLGKANATAIQSVQSSVQDLGDQVLAMAEIIDA
FT                   VNASIESINGTLAGQASAMTALTARVTASEGGINALAASTTTLSATVGDLSASGLLRIE
FT                   ARAGSGDVSARLVVLMRATTGSVWREVGTIWETGFTGGNPALPFARIANYADQFVIISP
FT                   IDDGRLPPFVVDTGLGQVIITEALIKRLMVNNFTLTGAGSKLLITSNPARIRATS"
     atgcccttca tcgccccgat cataggagcc gttggcgccg ccatcggcgc cgtcggttcg        60
     ttcgtcggca gcctcggcat cgtcggccag gcgctgctcg gcatcggcgc cagcgtgctc       120
     tccagcgtca tccagaagga gacggccgga aaggcggaga agcagcccgg cggcgtgcag       180
     ttcgaacggc aatatggcgg ggacgtgcca cggcaggttg cctgcggcct cgtcggcatc       240
     gccggccacg acacctatgt gaacaccttc gggccggcaa acggcatcct tcagcagatc       300
     tacacgctgt cggacttccc ctgccacggg ctgtcgcgcg tcgcgatcaa cggcaaatgg       360
     gtgacgctcg gcccggtcgg cgaagacggg atgcggaagg tcaccagcgg cgagtacgcc       420
     gacctcatcc gcgtccagtt cgtcgatggc acgcagaccg ccgcgctggc ggggcttgtc       480
     aactcggcaa atccgtccga ccggtggacc gccaatcaca tcggtgccgg cgtcgcctac       540
     gtctacatcg cgctggcctt caccgaaccg ctcaccaact tccccgactt cttcttcgag       600
     ttctatggcg cccggttcta cgactggcgc aaggattcga cggtcggcgg ctccggcggg       660
     catcgttggg gcaactacgc cacctatgag ttcaccgaaa acccggtggt gatcgaatac       720
     aactaccggc gcggcatcgc gtggaacggc gacatgttct gcggcatggc gatgccggcc       780
     gccgacctgc cgctggcgaa atggaccgcg gcggcgaaca tctgcgacga gacgacggac       840
     tacggcacgc gctaccgctg ctcgatcatg ctcgactgca ccgccatgca cggcgagaac       900
     atcacgtccc tgcagctgtc gtgcggggcc aagaaggtcg atgcggtgga tgggtcctgg       960
     ccgctggttg gccatgacca ggcggtggtc gccaccatca ccgacgacga cctgatcgtg      1020
     ggcgtgcggg ggcgctggac ggcgcgccgt tcgatgagcg atctggtcaa ccgggtctac      1080
     ggcacgttcc cgaaccccga caatctctgg tcgcccgccg actatgaact gcagggcggt      1140
     ggcgccctgg tggtgctcga tcgtcgcgac cgcgatgtgc cgctcgattt ccccatggtg      1200
     cgagttcccg gccaagccgc acagctggcc cgcatctatc tcgaggagaa ccgctacgag      1260
     gcgaccggcg acgaggtgtg gcgcccgcgg tttcaggtgc tggagcccgg cgattggatt      1320
     cgtcgcatcg gacgcacaca cggtgatcgc atctaccaga tcaccggcct gtcgctcgcc      1380
     tcgcacgatg ccgacggacc acgcaacgtc tcggtcagcc tgcaggaggt cgacggcgcg      1440
     atctatgacg gcatcacggc gccgccgatc gttgtgccga tgccgccggg ggcgccggtg      1500
     ctgctcaatg aggtgcagga tttcgacctc gcgccggtca ccgtgctcgg cgacgacggc      1560
     cgcttgctgc cggcgatccg ggcatcctgg gccagtatca cggatgtgac ggtggcctat      1620
     gtcgacctgc agtactggcc gacggcgcag ccgacctcgg tattcaccaa gcgcgtgccg      1680
     gctacggaga cgatcaccgt gctcgccgaa ggcgtcgtcc gcgcgaccga atacacggtc      1740
     aggacgaggc tggtgacgca gccgccccgc gtcacggtgt ggagcgccgg ggaaacggtg      1800
     accaccaccg ccattcctga cacggaaatc gacgtctacc tcgccaacat caagggcgac      1860
     gcctacgacg cgctgcggcg catgcgcgag gacctaaccg ccaacgtgca gaggatggac      1920
     atgttcgtcc gggacacctc ggtcggtctc ggaaggcagg tcacctccac cagcgtggcg      1980
     acgcggctcg gcaaggcgaa cgcgacggcg atccagagcg ttcagtccag cgtgcaggat      2040
     ctgggtgacc aggtccttgc aatggccgag atcatcgacg cggtgaatgc gtcgatcgag      2100
     agcataaacg ggacgctcgc cgggcaggcg tcggcgatga ccgcgctgac cgcgcgtgtc      2160
     acggcatcgg agggcggcat caacgccctg gccgcatcga cgacgacgct gtccgcgacc      2220
     gtcggcgatc tctccgcgtc cggcctgctg cgcatcgagg cccgtgccgg cagcggcgat      2280
     gtctccgccc gtctcgtcgt cctcatgcgc gcgacgacgg gaagcgtctg gcgcgaggtc      2340
     ggcacgatct gggagaccgg cttcaccggc ggcaacccgg ctctgccatt cgcgcgcatc      2400
     gccaactatg ccgaccagtt cgtcatcatc agcccgatcg acgacggccg cctgccgccc      2460
     ttcgtggtcg ataccgggct cggccaggtc atcatcaccg aagctctgat caagcggctg      2520
     atggtgaaca acttcaccct caccggcgcg ggcagcaagc tgctgatcac cagcaacccg      2580
     gcgcgcatca gggcgacgag ctga                                             2604
//

If you have problems or comments...

PBIL Back to PBIL home page