(data stored in ACNUC1104 zone)

EMBL: CP002026.PE280

CP002026.PE280       Location/Qualifiers
FT   CDS_pept        complement(272805..273305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0283"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: azc:AZC_2790 transcriptional regulator; PFAM:
FT                   regulatory protein MarR; SMART: regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87617"
FT                   /db_xref="GOA:D7A201"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A201"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADH87617.1"
FT                   /translation="MVAMTDVRESDGLMSAGGPDDPADAKALAIETYRLDQQVGFLMRV
FT                   ANQRHTALFAARMIENLTPPQFATLAKLREVGPCSQNRLGRLVYLDAATIKGVVDRLRA
FT                   RGFVLTADDPLDRRRRAVGLSERGRAVADEAILVAREITEATLEPLDEAERAEALRLLR
FT                   KLG"
     atggtggcca tgacggatgt gcgggaaagc gacgggctaa tgagtgcggg cggccccgac        60
     gatccggccg acgcgaaggc gctggcgatc gagacctacc ggctcgacca gcaggtgggc       120
     ttcctcatgc gcgtcgccaa ccagcgccac accgccctct tcgccgcgcg catgatcgaa       180
     aacctgaccc cgccgcaatt cgccaccctc gccaagctgc gcgaggtcgg cccctgctcg       240
     cagaaccggc tcggccgcct cgtctatctc gacgccgcca ccatcaaggg cgtggtggat       300
     cgcctgcgcg cccgcggctt cgtgctcacc gccgacgacc cgctggaccg ccgccgccgc       360
     gccgtcggcc tgtccgagcg cgggcgggcc gttgccgacg aagccatact ggtcgcgcgc       420
     gagatcaccg aggcgacgct ggagccgctc gacgaggccg agcgcgccga ggcgctgcgc       480
     ctgctgcgca agctcggctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page