(data stored in ACNUC1104 zone)

EMBL: CP002026.PE281

CP002026.PE281       Location/Qualifiers
FT   CDS_pept        complement(273367..274101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0284"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bbr:BB1775 putative ATP-binding component of
FT                   ABC transporter; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87618"
FT                   /db_xref="GOA:D7A202"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7A202"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87618.1"
FT                   /translation="MNPPADTPMLEVDGLEAWYGEAKILFGLSLTVAPGEAVALVGRNG
FT                   AGKSTTMKAVMGLVRRRARRLALHGQDIAALPTYAIARLGIGYVPEDRRIFTDLTVTEN
FT                   LDLGRRAVRPGGGSLMGPDWPREALFELFPNLAALRDRLGGQMSGGEQQMLAVARALVG
FT                   RPALLLLDEPSEGIAPIIVEQMINALGALKASGLSLLISEQNTALCSAVCNRAYVIEQG
FT                   ELRWQGAMSDLDSAVEPMRIFG"
     atgaatccgc ccgcggacac gcccatgctg gaggtcgacg ggctggaagc ctggtatggc        60
     gaggccaaga tcctgttcgg cctgtcgctc acggtcgcgc cgggcgaggc ggtggccctg       120
     gtcgggcgca acggcgccgg caagtccacc accatgaagg cggtgatggg gctggtgcgc       180
     cgccgcgccc gccgcctcgc cctgcatggg caggacatag cggcgctgcc gacctatgcc       240
     atcgcccggc tcggcatcgg ctatgtgccc gaggatcggc gcatcttcac cgacctcacc       300
     gtgacggaga acctcgacct cggccgccgc gccgtgcggc ccggcggcgg cagcctcatg       360
     ggccccgact ggccgcgcga ggcgctgttc gagctcttcc ccaacctcgc cgcgctcagg       420
     gatcgcctgg gcggccagat gtcgggcggc gagcagcaga tgctcgccgt ggcacgggcc       480
     ctcgtcggcc gcccggcgct gctgctgctc gacgagccct ccgaaggtat tgcgccaatc       540
     atcgtagaac aaatgatcaa tgcgctgggt gctttgaagg ccagcggcct ctccctgctg       600
     atctccgaac agaataccgc gttgtgcagt gcggtatgca accgggcgta tgtgatcgaa       660
     caaggcgaac tgcggtggca gggcgcgatg agcgacctcg attcggcagt cgagcccatg       720
     cggatattcg gttga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page