(data stored in ACNUC1104 zone)

EMBL: CP002026.PE282

CP002026.PE282       Location/Qualifiers
FT   CDS_pept        complement(274098..274871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0285"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bpy:Bphyt_4328 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87619"
FT                   /db_xref="GOA:D7A203"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D7A203"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH87619.1"
FT                   /translation="MTQNPAGTVLEVRELTKHYGGVRAVDGVSFSIAPGELLALIGPNG
FT                   AGKSTCFNIVNGQLKPDSGTVRILGRDVTGVPSRRIAHLGVGRTFQVAAVFGSMTALEN
FT                   VQAALIAARGSVFGFWRPATTIARDEAMALLEQTGMAGEAERPAAALAYGDVKRLELAM
FT                   ALAGDPRLLLMDEPTAGMAAAKRGEMIALVQKLTRSRGLAVLFTEHSMDVVFGHADRVI
FT                   VLARGRLIADGTVDEVRADPRVREVYLGGTAEAAR"
     atgacgcaaa acccggccgg aaccgtattg gaggtgcgcg agctcaccaa gcattatggc        60
     ggcgtgcgcg ccgtggacgg ggtgagcttc tccatcgcgc cgggcgaatt gctggcgctg       120
     atcggcccca acggcgccgg caagtcgacc tgcttcaaca tcgtcaacgg ccagctcaag       180
     ccggattccg gcacggtgcg catcctcggg cgcgacgtca ccggcgttcc ctcgcgccgc       240
     atcgcccatc tcggcgtcgg ccgtactttt caagtcgccg ccgtgttcgg ctcgatgacc       300
     gcgctggaga atgtgcaggc ggcgctcatc gccgcgcgcg gctcggtatt cggcttctgg       360
     cggcccgcga ccaccattgc ccgcgacgag gccatggcgc tgctggagca gaccggcatg       420
     gccggcgagg ccgagcgccc cgccgcggct ctcgcctatg gcgacgtgaa gcggctcgag       480
     ctcgccatgg cgctcgccgg cgatcccagg ctcctcctga tggacgagcc gaccgccggc       540
     atggccgcgg ccaagcgcgg cgagatgatc gcgctcgttc agaagctcac gcgctcgcgc       600
     ggactcgccg tgctgttcac cgagcattcc atggacgtcg tcttcggcca tgccgaccgg       660
     gtgatcgtgc tggcgcgcgg gcggctgatc gccgacggca cggtcgacga ggtgcgcgcc       720
     gacccgagag tgcgcgaggt ctatctcggc ggcacggcgg aggcggcaag atga             774
//

If you have problems or comments...

PBIL Back to PBIL home page