(data stored in ACNUC1104 zone)

EMBL: CP002026.PE283

CP002026.PE283       Location/Qualifiers
FT   CDS_pept        complement(274868..276766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0286"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: bbr:BB1773
FT                   putative permease component of branched-chain amino acid
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87620"
FT                   /db_xref="GOA:D7A204"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D7A204"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADH87620.1"
FT                   /translation="MSLDALLFQAVNGLASASGLFLVAAGLSIIFGVTRIVNMAHGSFY
FT                   MLGLYLAVTLAPKLGTWIGGPLGFWAGILAAALVVAALGALIEMTLLRRLYGAPELYQL
FT                   LATFALLLVINDAALFLWGPEDILGPRAPGLSGSVMLLGRRLPQYDIFLALIGPAVLIG
FT                   LHLLLARTRFGRLIRAATQDREMVAALGINEALLFTAVFALGAGIAGLGGALQMAREPA
FT                   SLTLDLSVLGDAFVVVVVGGMGSIRGAYLAAVLVAEAKALCTALGVVDIFGFTFNMSRL
FT                   TLVAEFLVMALVLIVRPHGLFGRPQPPAARGGPAEPPLRPFSAPARVFALAAIALFAAM
FT                   PLIGTLVSYAPVLALDMLVAALFAASLHFIMGPGGMASFGHAAYFGLGAYGTAYAVTAL
FT                   DLPTPLAFATGIGVAAFGAVLFGWFCVRLEGVYFAMLTLAFAQIVWSVAFQWEEVTGGS
FT                   NGLFDVWPEWPFDSRTGLYLAAFVVTLAGLMLLRRLVFAPFGMALRAARDSRLRAEASG
FT                   IPVARVRWLAFALAGAVCGAAGGLFAFAKGSISPEAISVGRSIDGLVMVLIGGVQSLVG
FT                   PVVGAGAFTLLQDSVMRETDYWRALLGVLILAIVLLFPFGIAGGLSRGLRRPGGAR"
     atgtcgctcg acgcgctcct gttccaggcg gtgaacggcc tcgcctccgc ctccggcctg        60
     ttcctcgtcg ccgccgggct gtcgatcatc ttcggcgtca cccgcatcgt gaacatggcg       120
     cacggctcct tctacatgct ggggctctat ctcgccgtga cgctggcgcc gaagctcggg       180
     acgtggatcg gcgggccgct cggcttctgg gccggcatcc tcgcggccgc gctcgtcgtg       240
     gcggcgctcg gcgcgctgat cgagatgacg ctgctgcgcc ggctctatgg cgcgcccgag       300
     ctctaccagc tgctcgccac cttcgcgctg ctcctcgtca tcaacgacgc ggcgctgttc       360
     ctctgggggc cggaggatat actcggcccg cgcgcgccgg gcctgtcggg ctcggtgatg       420
     ctgctcggcc ggcggctgcc gcaatacgac atcttcctcg cgctgatcgg cccggcggtg       480
     ctgatcggcc tgcacctcct gctcgcccgc acccgcttcg gccggctgat ccgcgcggcg       540
     acgcaggacc gcgagatggt ggcggcgctc ggcatcaacg aggcgctgct gttcaccgcg       600
     gtcttcgccc tcggcgccgg catcgccggg ctcggcggcg ccttgcagat ggcgcgcgag       660
     ccggcgagcc tcaccctcga cctctccgtg ctcggcgacg ccttcgtcgt cgtcgtggtc       720
     ggcggcatgg gctcgatcag gggcgcctat ctcgccgccg ttctggtggc ggaggcgaag       780
     gcgctgtgca ctgcgctcgg cgtggtcgac atcttcggtt tcaccttcaa catgtcgcgg       840
     ctgaccctgg tcgccgagtt cctggtgatg gcgctggtgc tgatcgtgcg cccgcacggc       900
     ctgttcggcc ggccgcagcc gcccgccgcc cgtggcggcc cggccgagcc gccgctgcgc       960
     ccgttctccg cccctgcccg cgtgtttgcc ctcgccgcca tcgccctgtt cgccgccatg      1020
     ccgctgatcg gcacgctggt cagctacgcc ccggtgctgg cgctcgacat gctggtggcg      1080
     gcgctgtttg ccgcctcgct gcacttcatc atggggccgg gagggatggc ctccttcggc      1140
     cacgccgcct atttcggcct cggcgcctac ggcaccgcct acgccgtcac cgcgctcgac      1200
     ctgccgaccc cgctcgcctt cgccaccggc atcggcgtcg cggccttcgg cgcggtgctg      1260
     ttcggctggt tctgcgtgcg gctggaaggc gtctacttcg ccatgctgac gctcgccttc      1320
     gcgcagatcg tctggtccgt cgccttccag tgggaggagg taacgggcgg ctccaacggc      1380
     ctgttcgacg tgtggccgga atggccgttc gacagtcgca ccgggctcta tctcgccgcc      1440
     ttcgtggtca cgctggccgg gctcatgctg ctgcggcggc tagtcttcgc gcccttcggc      1500
     atggcgttgc gcgccgcgcg cgattcacgc ctgcgggcgg aagcctccgg catcccggtg      1560
     gcgcgggtgc gctggctcgc cttcgcgctg gccggcgcgg tctgcggcgc ggcgggcggg      1620
     ctgttcgcct tcgccaaggg ctcgatctcg ccagaggcga tctcggtcgg ccgctccatc      1680
     gacgggctcg tcatggtgct gatcggcggc gtgcagagcc tcgtcggccc ggtcgtcggc      1740
     gccggcgcct tcacgctctt gcaggacagc gtgatgcgcg agaccgacta ctggcgcgcg      1800
     ctgctcggcg tgctgatcct cgccatcgtg ctgctctttc ccttcggcat cgcgggtggg      1860
     ctctctcgcg gcctgcgccg gccgggaggc gcgcgatga                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page