(data stored in ACNUC1104 zone)

EMBL: CP002026.PE287

CP002026.PE287       Location/Qualifiers
FT   CDS_pept        279769..280245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_1164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87624"
FT                   /db_xref="UniProtKB/TrEMBL:D7A208"
FT                   /inference="similar to AA sequence:KEGG:Xaut_1164"
FT                   /protein_id="ADH87624.1"
FT                   /translation="MNLFHRVLRLALAGMFAAALAACATQAPQPAAPAMPQYTSPITAQ
FT                   QLVGKWGLAAYHRPEDAARTEAQARQGCRQPYVINAGPGGGFMMYLADDSSPSEMVSKQ
FT                   VGTGPIFIGLPTEPAGAKSDREVVRFDGQILVLKWLDPEVAGRYGTMVYVRCPA"
     atgaacctgt tccaccgcgt cctccgcctg gctcttgccg gcatgttcgc cgccgctctc        60
     gccgcctgcg ccacccaggc cccgcagccg gcggcacccg ccatgccgca atacacatcg       120
     ccgatcaccg cccagcagct ggtcggcaaa tggggcctgg ccgcctatca ccgcccggag       180
     gacgcggcgc gcaccgaggc gcaggcgcgg cagggctgcc gccagcccta cgtcatcaat       240
     gccgggccgg gtggcggctt catgatgtac ctcgccgatg attcgtcgcc ttccgagatg       300
     gtgtcgaagc aggtcggcac cggcccgatc ttcatcggcc tgccgaccga gccggcgggc       360
     gccaagtccg accgcgaggt cgtgcgcttc gacggccaga tcctggtgct gaagtggctg       420
     gaccccgaag tggccggccg ctacggcacc atggtctatg tccgctgccc ggcgtga          477
//

If you have problems or comments...

PBIL Back to PBIL home page