(data stored in ACNUC1104 zone)

EMBL: CP002026.PE288

CP002026.PE288       Location/Qualifiers
FT   CDS_pept        280676..281674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0291"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rpb:RPB_1841 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87625"
FT                   /db_xref="GOA:D7A209"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D7A209"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADH87625.1"
FT                   /translation="MRGDSGLLSARQRAAVQAAAVAVALTALAAAGPAQAQSGVYGYQS
FT                   SYQLYSRSAASNPSAWRPGNAPVYPSGSVYQPPRPSADVGAARGVYGYAPPARRTTTAP
FT                   ASSYAASANPSGYDADVELPPAPVQAAAPTTRQTKAASRSTRGTATRTAAVPASYTVED
FT                   DIYDDPDTPLPLYRPSTGAKGVDRKFDRHVVRYSSSDPAGTIIVDTGARYLYLIQGDGT
FT                   AVRYGIGVGKEGFQWAGSERISRKAEWPEWRPPSEMLDRRPDLPRVMPGGEDNPLGARA
FT                   LYLGKSLYRIHGSNEPETIGQAVSSGCIRMRNEDVIDLYGRVQVGTLVRVI"
     atgcgcggtg attcgggtct cctttcagca cgtcagcggg cagccgtgca ggcggcggcc        60
     gtcgctgtcg cgctgacggc cttggccgct gcggggccgg cgcaggcgca gagcggcgtc       120
     tacggctacc agtcctccta ccagctctat tcgcgctccg cggcgtccaa tccttccgcc       180
     tggcggccgg gcaatgcgcc ggtctatccc tcgggcagcg tctatcagcc gccgcggccg       240
     agcgccgacg tcggcgccgc gcgcggggtc tatggatatg ccccgccggc ccgccggacc       300
     accaccgcgc cggcctcctc ctatgcggcg agcgcgaacc cgtctggtta cgacgccgac       360
     gtcgaattgc cgccggcgcc ggtgcaggcg gccgcgccga ccacgcgcca gaccaaggcg       420
     gcgagccgct cgaccagggg gacggcgacg cgcaccgccg ccgtgccggc cagctacacg       480
     gtcgaggacg acatctatga cgaccccgac acgccgctgc cgctctaccg gccctcgacc       540
     ggtgcgaagg gcgtcgaccg caagttcgac cgccacgtcg tgcgctattc cagctccgac       600
     ccggccggca ccatcatcgt cgataccggc gcgcgctatc tctacctgat ccagggcgac       660
     ggcacggcgg tgcgctacgg catcggcgtc ggcaaggaag gcttccagtg ggcggggagc       720
     gagcgcatca gccgcaaggc ggaatggccg gaatggcgcc cgccgtccga gatgctcgac       780
     cgccgtcccg acctgccgcg cgtcatgccc ggcggcgagg acaacccgct cggcgcccgc       840
     gcgctgtatc tcggcaagtc gctctaccgc atccacggct ccaacgagcc ggagaccatc       900
     ggccaggcgg tgtcctccgg ctgcatccgc atgcgcaacg aggacgtcat cgacctctat       960
     ggccgcgtgc aggtcggcac gctggtgcgg gtgatctga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page