(data stored in ACNUC1104 zone)

EMBL: CP002026.PE292

CP002026.PE292       Location/Qualifiers
FT   CDS_pept        284841..284960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0295"
FT                   /product="transmembrane efflux pump"
FT                   /note="KEGG: lxx:Lxx08160 transmembrane efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87629"
FT                   /db_xref="GOA:D7A213"
FT                   /db_xref="UniProtKB/TrEMBL:D7A213"
FT                   /inference="similar to AA sequence:KEGG:Lxx08160"
FT                   /protein_id="ADH87629.1"
FT                   /translation="MTTANFLLLLIMPVGALVVGGIVYLVASRDHHPHAGPAE"
     atgaccaccg cgaacttcct gctgctgctg atcatgccgg tcggcgccct ggtcgtcggc        60
     ggcatcgtct atctcgtcgc ttcgcgcgac catcaccccc acgccggccc cgccgagtga       120
//

If you have problems or comments...

PBIL Back to PBIL home page