(data stored in ACNUC1104 zone)

EMBL: CP002026.PE293

CP002026.PE293       Location/Qualifiers
FT   CDS_pept        285080..286309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0296"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; KEGG:
FT                   azc:AZC_3913 DNA/pantothenate metabolism flavoprotein;
FT                   PFAM: flavoprotein; DNA/pantothenate metabolism
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87630"
FT                   /db_xref="GOA:D7A214"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D7A214"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ADH87630.1"
FT                   /translation="MLATKRILLIIGGGIAAYKSLDLIRRLKERGASVRVIMTAAAQHF
FT                   VTPLAAGALSHERVFTELFDREAEHDIGHIRLSREADLIIVAPATADLMAKMAHGLADD
FT                   LASAVLLASDKPVLVAPAMNPLMWSHAATRRNAAQLAADGVAFIGPNAGAMAERGEDGP
FT                   GRMAEPMEIVEAAERLLAASGPLKGRHVLVTSGPTHEPIDPVRYIANRSSGKQGHAIAA
FT                   AAARAGAQVTLVSGPVNLPDPAGVDVRHVESARDMLAAVEAALPADAAIFAAAVADWRA
FT                   ASEAGEKLKKDGNAIPPLMLTENPDILATVAHLSNRRPRLVVGFAAETQNVVAYAQAKR
FT                   ARKGCDWIVANDVSQHSGIAGGVMGGDSNAVHLITAEGVEHWPEASKAAVAEKLIARVA
FT                   ASLGPLGAAE"
     atgctcgcga ccaagcgcat cctgctgatc attggcggcg gcatcgccgc ctataagagc        60
     ctcgacctga tccgccggct gaaggagcgc ggcgcctcgg tgcgggtgat catgaccgcg       120
     gcggcgcagc acttcgtcac cccgctggcg gcgggcgcgc tctcgcatga acgcgtcttc       180
     accgagctgt tcgaccgcga ggccgagcac gacatcggcc atatccgcct gtcgcgcgag       240
     gcggacctca tcatcgtcgc ccccgccacc gccgacctga tggcgaagat ggcgcacggc       300
     ctcgccgacg acctcgcttc cgccgtgctg ctggcgagcg acaagccggt cctcgtcgcc       360
     ccggcgatga acccgctgat gtggagccac gccgccacgc gccgcaacgc cgcccagctt       420
     gccgccgacg gcgtcgcctt catcggcccg aatgcgggcg ccatggccga gcgcggcgag       480
     gacgggccgg gccgcatggc cgagccgatg gagatcgtcg aggccgccga gcgcctgctg       540
     gcagcttccg gcccgctcaa aggccggcat gtgctggtga cctcgggccc gacgcacgag       600
     ccgatcgatc cggtgcgcta catcgccaac cgttcctccg gcaagcaggg ccacgcaatc       660
     gccgccgctg ccgcccgtgc gggggcgcag gtgacgctgg tctccggccc ggtgaatctg       720
     cccgaccccg ccggcgtcga tgtccgccat gtcgagagcg cccgcgacat gctggcggcg       780
     gtcgaggccg cgctgccggc cgacgccgcc atcttcgccg ccgccgtggc cgactggcgc       840
     gccgcgagcg aggcgggcga gaagctgaag aaggacggca acgccatccc cccgctcatg       900
     ctgaccgaga atcccgacat actcgccacc gtggcgcatc tgtcgaaccg ccggccgcgc       960
     ctcgtcgtcg gcttcgcggc ggagacgcag aacgtcgtcg cctacgcgca ggccaagcgt      1020
     gcgcgaaaag gctgcgactg gatcgtcgcc aacgacgtct cgcagcacag cggcatcgcc      1080
     ggcggggtga tgggcggcga cagcaacgcg gtccatctca tcaccgcgga gggtgtcgag      1140
     cactggccgg aggcctccaa ggccgcggtg gccgagaagc tgatcgcccg tgtcgccgcc      1200
     tcgctcggcc cgctgggggc cgccgaatga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page