(data stored in ACNUC1104 zone)

EMBL: CP002026.PE294

CP002026.PE294       Location/Qualifiers
FT   CDS_pept        286306..286791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0297"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /note="KEGG: azc:AZC_0707 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87631"
FT                   /db_xref="GOA:D7A215"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D7A215"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ADH87631.1"
FT                   /translation="MSFEASLDVAVLVLPHGEGLPLPEYATAGSAGLDLLAALPGDEPL
FT                   TLAPLARAAVPTGLSIALPEGYEAQVRPRSGLALKQGLTVLNAPGTIDSDYRGEVKVLL
FT                   VNLSDQPVVLERGQRIAQMVVAPVTRIKLVETGDLNETTRGSGGFGSTGLDGRHISR"
     atgagcttcg aagcgagtct ggacgtcgcc gtcctggtgc tgccgcatgg cgagggcctg        60
     ccgctgccgg aatacgccac ggcgggctcc gccgggctcg acctcctcgc tgcgttgccc       120
     ggagacgagc cgttgacgct cgccccgctc gcccgcgcgg cggtgccgac cgggctctcc       180
     atcgccctgc cggaaggcta cgaggcgcag gtgcgcccgc gctccggcct cgctctcaag       240
     caggggctga ccgtgctcaa cgcgccgggg accatcgatt ccgactatcg cggcgaggtg       300
     aaggtactgc tggtcaacct cagtgaccag cctgtggtgc tggagcgcgg ccagcgcatc       360
     gcgcagatgg tggtcgcgcc ggtgacgcga attaagctgg tcgagaccgg ggatttgaac       420
     gaaacaacac gcggtagcgg tggattcggc tcgacggggc tcgacgggcg gcacatatcg       480
     cgctag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page