(data stored in ACNUC1104 zone)

EMBL: CP002026.PE297

CP002026.PE297       Location/Qualifiers
FT   CDS_pept        288476..290995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0300"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: met:M446_0500 multi-sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87634"
FT                   /db_xref="GOA:D7A218"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7A218"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADH87634.1"
FT                   /translation="MAHPAGMGGERNQGGRVPQVRPGRRLLRPLFTGLAFAAPIAPASA
FT                   APASDVFAVLAVQDPSVLIGLALVVGLIVFATTTAIVHLRYRRQSLRREMAAFGEISRL
FT                   EAQIDEARALLMAEPQIVVVWRDPAADPEIIGNTPAFTGVAAPARILAFGSWLTPASAR
FT                   EIEAAVDRLRGRGTPLAATLATQDGRFVEADGRPVGAAVVLRLRDITGVRLDQAQLEAA
FT                   YRALDAESSALRTLLDALPAPAWVDGEDGRLRWSNAAYAHAVEARDASDAASRGLMLLD
FT                   QQSRTQAEKAHAASLPFKARLPVVVAGTRRVLDVLEVPAGGGAAGIALDATEAEVVRAE
FT                   LAQVVGAHRRTLDQLATAVAIFGADQRLVFHNAAYARLFDLDAAFLDDRPTDGAVLDRL
FT                   RAARRLPEQADFRLWREELHAAYRAIEPREHWWHLPGGRTLRVVTAPNPEGGITYLFDE
FT                   VTERLALESRFNSLTRIQSETLDALAEAVAVFGSDGRLGLVNSAFRRLWQLDAAMLDAH
FT                   PHIDAVAAACRPLTADAAVWARLTATVTGIEARMPTEFRMERNDRTILDGSTQPLPDGA
FT                   TLVTLRDVTDSVNVERALVERNDALVAADHLKSTFVSHVSYELRSPLTTIIGFAQLLDD
FT                   TGIGPLNVKQRAYVNHITESSAALLAIINDILDLATIDAGSMALELTEVDVRAAMDAAA
FT                   EGVRDRLAEGGIRLSIELQNAAGSFRADAKRVRQILYNLLSNAVGFAPEGSTVTLSAER
FT                   REDGVIFRVRDMGPGVPPEIGARAFDRFESHTAGSRHRGVGLGLSIVRSLVALHGGTVS
FT                   LAPAQGGGTLVTCIFPLEAGASRDAAE"
     atggcgcatc cggccggcat gggcggagaa cggaaccaag ggggacgggt gccgcaggtg        60
     cggcccggcc gccggctcct ccgcccgctc ttcaccggcc tcgcttttgc cgcgccgata       120
     gcgcccgctt ccgccgcccc ggcctccgac gtcttcgccg tgctggcggt gcaggacccg       180
     agcgtgctga tcggccttgc gctggtcgtc ggtctcatcg tcttcgccac caccaccgcc       240
     atcgtgcatc tgcgctatcg ccgccagtcg ctgaggcgcg agatggcggc gttcggcgag       300
     atttcccgtc tcgaagccca gatcgacgag gcgcgcgccc tattgatggc cgagccgcag       360
     atcgtcgtgg tctggcgcga tcccgccgcg gacccggaga tcatcggcaa cacgcccgcc       420
     ttcaccggcg tcgccgcccc cgcccgcatc ctcgccttcg gttcatggct cacccccgct       480
     tccgcccgcg agatcgaggc ggcggtggac cggctgcgcg gccgcggcac gccgctcgcc       540
     gccaccctcg ccacgcagga cggccgcttc gtcgaggcgg atggccgccc ggtcggcgcc       600
     gcggtggtgc tgcgcctgcg cgacatcacc ggcgtgcggc tcgaccaggc gcagctggaa       660
     gccgcctatc gcgccctcga tgccgagagc tcggcgctgc gcacgctgct cgatgcgctg       720
     ccggcgcccg cctgggtcga cggcgaggat ggcaggctgc gctggagcaa tgccgcctat       780
     gcccatgcgg tggaggcgcg cgacgcttcc gacgccgcct cgcgcggcct catgctgctc       840
     gaccagcaga gccgcaccca ggccgagaag gcgcatgcgg cgagcctgcc cttcaaggcc       900
     cgcctgccgg tggtggtcgc cggcacgcgg cgcgtgctcg acgtgctgga agtgccggcc       960
     ggcggcggcg cggcgggcat cgcgctcgac gccaccgagg ccgaggtggt gcgtgcggag      1020
     ctcgcccagg tggtcggcgc gcaccggcgc acgctcgacc agctcgcaac cgccgtggcg      1080
     atcttcggcg ccgaccagcg cctcgtcttc cacaatgccg cctatgcccg gctgttcgac      1140
     ctcgacgccg ccttcctcga cgaccggccg accgacggcg ccgtgctcga ccggctgcgc      1200
     gccgcgcggc gcctgccgga gcaggccgat ttccgcctct ggcgcgagga gctgcacgcc      1260
     gcctaccgcg ccatcgagcc gcgcgagcac tggtggcacc tgccgggtgg gcgcacgctg      1320
     cgcgtcgtca ccgcgccgaa cccggaaggc ggcatcacct atctgttcga cgaggtgacc      1380
     gagcggctcg cgctggagag ccgcttcaac tcgctcaccc gcatccagtc cgagacgctg      1440
     gacgccttgg cggaggcggt ggcggtgttc ggcagcgacg gccggctcgg cctcgtcaat      1500
     tccgccttcc gccggctctg gcagctcgac gccgccatgc tcgacgccca tccgcatatc      1560
     gacgcggtgg ccgccgcctg ccgcccgctg accgccgacg ccgcggtctg ggcgcggctc      1620
     accgccacgg tgaccggcat cgaggcgcgc atgccgaccg agttccgcat ggagcgcaac      1680
     gaccgcacca tcctcgacgg ctcgacccag ccgctgcccg acggcgccac gctggtgacg      1740
     ctgcgcgacg tcaccgacag cgtcaacgtc gagcgggcgc tggtggagcg caacgacgcc      1800
     ctcgtcgccg ccgaccatct caagagcacc ttcgtcagcc acgtctccta tgagctgcgc      1860
     tcgcctttga ccacgatcat cggcttcgcc cagctgctcg acgacaccgg catcggcccg      1920
     ctcaacgtca agcagcgcgc ctatgtgaac cacatcaccg agagctcggc ggcgctgctc      1980
     gccatcatca acgacatcct cgacctcgcc accatcgatg ccggctccat ggcgctggag      2040
     ctgaccgagg tcgatgtgcg cgccgccatg gacgcggcgg ccgagggcgt gcgcgaccgg      2100
     ctcgccgagg gcggcatccg cctctccatc gagttgcaga acgccgccgg ttccttccgc      2160
     gccgatgcca agcgcgtgcg gcagatcctc tacaacctgc tctccaatgc ggtgggcttc      2220
     gcgccggagg gctcgaccgt cacgctctcg gccgagcggc gcgaggacgg cgtgatcttc      2280
     cgcgtgcgcg atatggggcc gggcgtcccg ccggagatcg gcgcccgggc gttcgaccgc      2340
     ttcgagagcc acaccgccgg ctcgcgccac cgcggcgtcg ggctcggcct ctccatcgtg      2400
     cgctcgctgg tggcgctgca tggcggcacg gtgagcctgg cgccggcgca gggcgggggc      2460
     acgctggtga cctgcatctt cccgctggaa gccggcgcga gccgcgacgc ggcggagtag      2520
//

If you have problems or comments...

PBIL Back to PBIL home page