(data stored in ACNUC1104 zone)

EMBL: CP002026.PE3

CP002026.PE3         Location/Qualifiers
FT   CDS_pept        1669..2010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0003"
FT                   /product="bacteriophage protein"
FT                   /note="KEGG: avi:Avi_6150 bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZS6"
FT                   /inference="similar to AA sequence:KEGG:Avi_6150"
FT                   /protein_id="ADH87340.1"
FT                   /translation="MSAYPFSNLPARLAALVLVCPERGCWIWQGATSGRGRGGGYGRVK
FT                   WDGVTQAVHKVVWRIAGRRPLRRGEQLDHECRVRACCNPAHLKPMYQPKNMRLAYARRR
FT                   AAFRAEAVQ"
     gtgagcgctt atcccttctc caatcttccc gcccggcttg ccgccctggt gctggtgtgc        60
     cccgaacgcg gctgctggat atggcagggc gccaccagcg gccgcggccg gggcggcggc       120
     tatggccgtg tgaaatggga tggcgtcacc caggccgtgc acaaggtggt gtggcggatc       180
     gccgggcggc gtccgctgcg ccggggcgag cagttggacc atgagtgccg cgtgcgggcg       240
     tgctgcaacc cggcgcacct gaagccgatg taccagccga agaacatgag gctggcctat       300
     gcgcgccgcc gcgcggcctt tcgggcggag gcggtgcagt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page