(data stored in ACNUC1104 zone)

EMBL: CP002026.PE30

CP002026.PE30        Location/Qualifiers
FT   CDS_pept        24049..25224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87367"
FT                   /db_xref="InterPro:IPR021251"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH87367.1"
FT                   /translation="MPTSPSVFRAGVVAVTAGSPIVLGTGTGFLLNGVTGGMFSLAGHA
FT                   VPVLSADSETQLTLAYDWPGATASGVADYAISLESALAADATFVHNRLVSVLDAIGAIE
FT                   NARPNYEVLSVGSNAPPGSPVVGGLYVVGTVPNGAWVGQANNLAQWTGAAWLFTAPERG
FT                   TTVVSAATGIVSIWNGTTWGAYVAPSSFIATLMDDASASAALSTLGVSDFAKTILDDTT
FT                   AAEARTTLGATAFRALGTLTGAAGSFARFTGAGGADAVMQAIVGTVSQSAGVPTGAIVE
FT                   AGSNGNGNYVKFADGTMVCWATFAVRAINIASSAVIGGFRSAAIIPTFPIAFAAVPAIV
FT                   TFATGGSGASGSAITACDSSAPTTGNFSFYLAASVNTTAAGAGYVAIGRWY"
     atgccgactt caccttcggt cttccgggcc ggcgtcgtcg ccgtcacggc gggttctcct        60
     attgtccttg gcaccggcac cggctttctt ctcaacggcg tcaccggcgg catgttctcg       120
     ctggcgggtc acgccgtccc ggttctctcg gcggattcgg aaacccagct gacgctcgcc       180
     tatgactggc ccggggcgac cgcctcgggc gtcgcggact atgcgatctc gctcgaaagc       240
     gcgctggcgg ccgacgcgac cttcgtgcac aaccggctgg tcagcgtgct cgacgccatt       300
     ggagcgatcg aaaatgcgcg accgaactat gaggttctgt cggtcgggag caatgcccca       360
     ccgggctcgc cggtggtagg cggtctctat gtcgtcggca ccgtaccgaa tggcgcctgg       420
     gtgggacagg ctaacaacct ggcgcagtgg accggagccg cttggctttt caccgctccg       480
     gagcgcggca cgacggtggt gagcgccgcg accggcatag tttcgatctg gaacggtacg       540
     acgtggggcg cttatgtcgc gccgtcgtcg ttcatcgcaa ccctaatgga cgatgctagc       600
     gcatcggcgg ctctgtcgac gctgggtgtg tcagatttcg ccaaaacgat cctcgacgac       660
     actaccgctg ccgaagcccg caccacgctc ggtgcgacgg cgtttcgggc gctgggcaca       720
     ttgaccggtg ctgctggctc tttcgcccgc ttcaccggcg cgggcggcgc cgatgccgtg       780
     atgcaggcga tcgttgggac ggtgagccag agcgctggcg tcccaaccgg tgcgatcgtc       840
     gaagcgggat ccaatggcaa cggcaactac gtcaaattcg ccgatggcac gatggtctgc       900
     tgggcgacct ttgctgtgcg ggcgatcaat atcgccagtt ctgcggttat cggcggcttc       960
     cggtccgctg caatcatacc gacgtttccc atcgcttttg ccgcagttcc ggcgatcgtc      1020
     acgtttgcga cggggggatc tggcgcaagt gggtcagcaa ttacggcatg tgacagtagt      1080
     gctccgacta ccggaaattt ctctttttac ctagccgctt cggtgaacac taccgcggcc      1140
     ggagcgggat atgttgccat cggccgctgg tattga                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page