(data stored in ACNUC1104 zone)

EMBL: CP002026.PE300

CP002026.PE300       Location/Qualifiers
FT   CDS_pept        293599..296640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0303"
FT                   /product="double-strand break repair protein AddB"
FT                   /note="TIGRFAM: double-strand break repair protein AddB;
FT                   KEGG: azc:AZC_0713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87637"
FT                   /db_xref="GOA:D7A221"
FT                   /db_xref="InterPro:IPR014153"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D7A221"
FT                   /inference="protein motif:TFAM:TIGR02786"
FT                   /protein_id="ADH87637.1"
FT                   /translation="MSRPDPNLLTIPASAPFLAVLADALLDGRLVEGFAPRHDPFALAS
FT                   ATVFLPTRRAGRLLAEALRARMESGVTLLPRIVPLGDVDEDSLAFAESFTDPPRAVPGM
FT                   TRRLALASLVRRWRRLLAGDDGRVAVAAGPGAEFALADALAHLIDEMAAQQVPWEKLDT
FT                   LVPGQHDLYWDMALDFLKIAREFWPALLDELGAVDASVRRDRLIAAEAERLRAAPAGPV
FT                   IAAGSTGSMPATARLLAAVAHLTDGCVVLPGLDTDLDARSWDHLTDDEAPAPSHPQYGL
FT                   ALLLKAHMRVGRDAVRSLAPPAPHGRERLLSEALRPVASTEAWASLAERLGAAEIDAAL
FT                   AEVSVIEADDAREEALAIAVALREALEEPGRSAALVTPDRDLARRVAAELLRFEVAIDD
FT                   SAGEPLSESAPGRFARLVADACDAELAPVPLSALLRHPLARFGLERGALDQAADALELM
FT                   VLRGPRPEAGADGLVRAVAGFSPGLHHSSDPRAAIDTDRQALAAGLAERIARAFGPLLA
FT                   LGAGEHPFATLLEAHRAAVAAAWSAEDGGAAEDAIALAELSKTFEAMAEGASEAPVMRL
FT                   ADYAAALPLLLADRPVRPPLLPGARLRILGPLEARLVSVDRMVLAGLVEGTWPSAVRTD
FT                   PWLSRPMRAALGLEAPERRIGLSAHDFAQGCGAPELILSHPRKLGGAPTVPSRFLQRLE
FT                   AVSGEARWKMAKLRGDRFRRLAALIEEAPAASRIARPEPAPPVELRPKRLSVTEIETWL
FT                   RDPYTIYARHVLRLRPLDMLDEAPGAAERGSAIHDALGAFAQAFPEALPAEPEAGLLAF
FT                   GREAFRELEAFPAEYALWWARFERLVPRYIGWERARRADTRRVFAELGGRMALAGGRFA
FT                   LTGRADRIEQLREGGLAIIDFKTGAVPTAKQTAAHYSPQLPLEAAMAAAGGFRDLPAEG
FT                   AAALTYVRLGTSELKEVGAVDRDETAFGLAASTLERLEQLIATFEDPSRGYASLARPMF
FT                   RGRFGDYDHLARVKEWSTGGEGEE"
     atgagccgtc cggaccccaa tctcctgacc atccccgcct cggcgccctt cctcgccgtg        60
     ctggccgacg cgctgctcga cggccggctg gtggagggct tcgcgccgcg ccacgacccg       120
     ttcgcgctgg cgagcgccac cgtcttcctg ccgacccgcc gtgccggccg cctgctggcc       180
     gaggcgctgc gcgcccgcat ggaatcgggc gtgacgctgc tgccgcgcat cgtgccgctc       240
     ggcgacgtcg acgaggattc gctcgccttc gccgagagct tcaccgaccc gccgcgtgcc       300
     gtgccgggca tgacccgccg gctggcgctg gcgagcctcg tgcggcgctg gcggcgactg       360
     ctcgccggcg atgacggccg cgtcgcggtg gcggcggggc cgggggcgga gttcgcgctg       420
     gccgatgcgc tcgcccatct catcgacgag atggcggcgc agcaggtgcc gtgggaaaag       480
     ctcgacacgc tggtgcccgg ccagcacgac ctctactggg acatggcgct cgacttcctg       540
     aagatcgccc gcgagttctg gccggcgctg ctcgacgagc tcggcgcggt cgatgccagc       600
     gtgcggcgcg acaggctgat cgccgccgag gcggagcggc tcagggccgc gcccgccggc       660
     ccggtgatcg ccgccggctc gaccggctcc atgccggcca ccgcccgcct gctggcggcc       720
     gtcgcgcatc tcaccgatgg ctgcgtggtg ctgcccggcc tcgacaccga cctcgacgcc       780
     cgctcctggg atcatctcac cgatgacgag gcgccggcgc cgagccaccc gcaatatggc       840
     ctcgcgctgc tgctgaaagc ccatatgcgg gtcgggcgcg acgcggtgcg aagcctcgcg       900
     ccgccggcgc cgcatgggcg cgaaaggctg ctctccgagg cgctgcgtcc cgtcgcctcc       960
     accgaggcct gggcgagcct tgccgagcgc ctcggcgcgg cggagatcga cgcggcgctg      1020
     gccgaggtca gcgtcatcga ggcggacgac gcccgcgagg aggcgcttgc catcgccgtg      1080
     gcgctgcgcg aggcgctgga ggagccgggc cgcagcgccg ccctcgtcac ccccgaccgc      1140
     gacctcgccc gccgcgtcgc cgcggagctg ctgcgcttcg aggtcgccat cgacgattcc      1200
     gccggcgagc cgctgtccga gagcgcgcca ggccgcttcg cccggctggt ggcggatgcc      1260
     tgcgacgccg agctggcgcc ggtgccgctc tcggcgctcc tgcgccatcc gctcgcccgc      1320
     ttcgggctgg agcgcggggc gctcgatcag gccgccgacg cgctggagct gatggtgctg      1380
     cgcggcccgc gcccggaggc gggagcggat gggttggtca gggccgtcgc gggcttctca      1440
     ccggggctgc atcattcttc cgatccgaga gcggccatcg acacggatcg gcaggccctc      1500
     gccgccggcc tcgcggagag gatcgctagg gcgttcgggc cgctgctggc actgggcgcg      1560
     ggcgagcacc ccttcgcgac cttgctggag gcgcatcgcg cggccgtcgc ggcggcgtgg      1620
     agcgcggagg atggcggcgc ggcggaggac gccatcgcgc tggccgagct ttccaagacc      1680
     ttcgaagcca tggccgaagg ggcgagcgag gcgccggtga tgcgcctcgc cgactatgcc      1740
     gctgccctgc ctctgcttct ggcggaccgt ccggtccgtc cgccgctgct gcccggcgct      1800
     cggctgcgca ttctcggccc gctggaagcg cgcctcgtca gcgtcgaccg catggtgctc      1860
     gccgggctcg tcgagggcac ctggccgagc gcggtgcgca ccgatccctg gctcagccgg      1920
     ccgatgcgcg cggcgctggg gctggaggcg ccggagcggc gcatcggcct ttccgcgcac      1980
     gacttcgcgc agggctgcgg cgcgcccgaa ctgatcctgt cgcatccgcg caagcttggc      2040
     ggcgcgccga ccgtgccctc gcgctttctc cagcggctgg aagcggtgag cggggaggcg      2100
     cgctggaaga tggcgaagct ccgcggcgac cgcttccgcc gtcttgccgc gttgatcgag      2160
     gaggcgccgg cggcgtcgcg catcgcaagg ccggagccgg cgccgccggt cgaattgcgc      2220
     ccgaagcggc tctccgtcac cgagatcgag acctggctgc gcgaccccta caccatctat      2280
     gcccgccatg tgctgcggct gcgcccgctc gacatgctgg acgaggcgcc cggcgcggcc      2340
     gagcgcggca gcgccatcca cgacgccctc ggcgccttcg cgcaggcttt tcccgaggcc      2400
     ctgccggcgg agcccgaggc ggggctgctc gccttcgggc gggaggcgtt ccgggagctg      2460
     gaggccttcc ccgccgaata cgcgctgtgg tgggcgcgct tcgagcggct cgtgccgcgc      2520
     tatatcggct gggagcgggc gcggcgcgct gatactcgcc gcgtcttcgc cgagctgggc      2580
     gggcgcatgg cgctggcggg cggacgcttc gccctcaccg gccgcgccga ccgcatcgag      2640
     caattgcgcg agggcgggct ggcgatcatc gacttcaaga ccggcgccgt gcccacggcc      2700
     aagcagaccg ccgcgcatta ttcgccgcag ctgccgctgg aagccgcgat ggcggcggcg      2760
     ggcgggttcc gcgacctgcc ggcggaaggc gcggcggcgc tgacctatgt gcggctcggc      2820
     acgagcgagc tgaaggaggt cggcgcggtc gacagggacg agaccgcctt cggcctcgcc      2880
     gcctcgacgc tggaacggct ggagcaattg atagccacct tcgaagatcc ttcgcgcggc      2940
     tatgcctcgc tggcgcggcc gatgttccgc ggccgcttcg gcgactacga ccacctcgcc      3000
     cgtgtgaagg aatggtcgac cggcggggag ggcgaggaat ga                         3042
//

If you have problems or comments...

PBIL Back to PBIL home page