(data stored in ACNUC1104 zone)

EMBL: CP002026.PE303

CP002026.PE303       Location/Qualifiers
FT   CDS_pept        300627..301133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0306"
FT                   /product="Domain of unknown function DUF1993"
FT                   /note="PFAM: Domain of unknown function DUF1993; KEGG:
FT                   vap:Vapar_2424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87640"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D7A224"
FT                   /inference="protein motif:PFAM:PF09351"
FT                   /protein_id="ADH87640.1"
FT                   /translation="MPLSIYDASIPVFERALRNLDAILTKAEEHAAANGIDLSELAAAR
FT                   LAPDMFPLTGQIQSASDSAKFAAARLTGTTGPSFADTETTFEELHARIAKTLDYLASVD
FT                   RAGFEGAETREIVQKSRRGERHFVGQAYLLTFALPNFFFHVTTAYDILRHKGVPVGKSD
FT                   YLGAF"
     atgccgcttt ccatctacga cgcctcgatc ccggtctttg agcgcgcgct gcgcaacctc        60
     gacgccatcc tcaccaaggc cgaggagcac gctgccgcca acggcatcga tctttccgag       120
     ctcgccgcgg cgcggctggc gcccgacatg ttcccgctca ccggccagat ccagagcgcc       180
     agcgattccg ccaaattcgc cgccgcccgg ctgaccggca ccaccgggcc gagcttcgcc       240
     gacaccgaga cgaccttcga ggagctgcac gcgcgcatcg ccaagacgct ggactatctc       300
     gccagcgtcg accgggccgg cttcgagggc gcggagaccc gcgagatcgt gcagaagtcg       360
     cggcgcggcg agcggcattt cgtcggtcag gcctatctcc tgaccttcgc cctgccgaac       420
     ttcttcttcc acgtcaccac cgcctacgac atcctgcgtc acaagggcgt tccggtcggc       480
     aagagcgact atctcggggc gttctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page