(data stored in ACNUC1104 zone)

EMBL: CP002026.PE304

CP002026.PE304       Location/Qualifiers
FT   CDS_pept        301435..303363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0307"
FT                   /product="Gluconate 2-dehydrogenase (acceptor)"
FT                   /EC_number="1.1.99.3"
FT                   /note="KEGG: azc:AZC_0150 hypothetical protein; PFAM:
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87641"
FT                   /db_xref="GOA:D7A225"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D7A225"
FT                   /inference="protein motif:PRIAM:1.1.99.3"
FT                   /protein_id="ADH87641.1"
FT                   /translation="MSGARKRGIVFGLAAAFWGLGLAPAPAQTPAAPDDSALVARGEYL
FT                   ARAADCMPCHTGDKAKPFAGGLGLNTPFGTLYSVNITSDVATGIGSWSFDDFRRALHDG
FT                   IRKDGAYLYPAMPFDAYTGITEDDLKALWAYVRRIPAVNAPNPENGLSFPFNIRLGMLA
FT                   WRELFFQPAFFKPTPGKSDEWNRGAYLVEALGHCSDCHSPRNIMGAIKGKEAFTGAEVD
FT                   GFYAPDIASGALGKTWRKDMLIQFLKTGSAPQKTVVFGPMAEVVHDSLSHLTDADLAAM
FT                   ATYLLESPPPLDAPAPQKASPLPADVYARASKLFIDNCAVCHQQQGTGLLGAIPSLAGN
FT                   PAVTAAEPYNVIAATLHGLPSDGHYGTMPSFAGRLSDQQIADVVNYVRTAWGNQGTPNA
FT                   TPRMVAAWRETVKVPDYGTQAASAFDCAQVGGAPGAPGPDPKAVAALTAAIAGGNREVS
FT                   SLVESYEAAAPNASPAQVVDALMAAYCPVVAAGAGEDYQKYARLKGFTLQAAADVSFRG
FT                   TPDSLPDVPVVTAVVAGKSLVARQPESLAGPLACPAAGKIPADLVTAAAGLIGKPQLPV
FT                   PGGAGGGYARELVTKNPKARPADIANALILSYCGLVAADKGIEPATQHAYVEDFGQQVI
FT                   QTLQVQP"
     atgtcgggtg cgcgcaaacg gggcatcgtg ttcggtctgg cggcggcgtt ctggggcctc        60
     ggtctcgctc ccgccccggc gcagacgccg gcggctcccg acgattcggc cctcgtcgcc       120
     cgcggcgaat atctcgcccg cgccgccgac tgcatgccct gccacaccgg cgacaaggcc       180
     aagcccttcg ccggcgggct cgggctgaac acacccttcg gcacgctcta ttcggtcaac       240
     atcacctcgg acgtggcgac cggcatcggc tcctggtcct tcgacgactt ccggcgggcg       300
     ctgcatgacg gcatccgcaa ggacggcgcc tatctctacc cggccatgcc gttcgacgcc       360
     tataccggca tcaccgagga cgacctcaag gcgctctggg cctatgtccg gcgcatcccg       420
     gcggtgaacg cgcccaaccc ggagaacggg ctttccttcc ccttcaacat ccgcctgggc       480
     atgctggcct ggcgcgaact gttcttccag ccggccttct tcaagccgac gccgggcaag       540
     agcgacgagt ggaaccgcgg cgcctatctg gtcgaggcgc tcggccactg ctcggattgc       600
     cacagcccgc gcaacatcat gggcgcgatc aagggcaagg aagccttcac cggcgccgag       660
     gtcgacggct tctacgcccc cgacatcgcc tccggcgcgc tgggcaagac ctggcgcaag       720
     gacatgctga tccagttcct caagaccggc tctgcgccgc agaagaccgt ggtgttcggc       780
     ccgatggcgg aggtggtgca tgacagcctc tcccacctga ccgacgccga cctcgccgcc       840
     atggcgacct atctgctgga gagcccgccg ccgctcgacg cgccggcgcc gcagaaggcc       900
     tcgcccttgc cggcggacgt ctatgcccgc gcctcgaagc tgttcatcga caattgcgcc       960
     gtctgtcacc agcagcaggg caccggcctg ctcggcgcca ttccctcgct tgccggcaac      1020
     ccggcggtga cggcggccga gccctacaac gtcatcgccg ccacgctgca cggcctgccc      1080
     tccgacggcc attacggcac catgccgtcc ttcgccgggc ggctgtcgga ccagcagatc      1140
     gccgatgtgg tgaactatgt ccgcaccgcc tggggcaacc agggcacgcc caacgccacg      1200
     ccgcgcatgg tcgccgcctg gcgcgagacg gtgaaggtcc cagactacgg cacgcaggcc      1260
     gcctccgcct tcgactgcgc ccaggtcggc ggcgcgcccg gcgcgccggg gccggacccg      1320
     aaggcggtcg ccgcgctcac cgccgccatc gccggcggca atcgcgaggt ctcctcgctg      1380
     gtcgagagct atgaggcggc cgcgccgaat gcctcgccgg cccaggtggt cgacgcgctg      1440
     atggccgcct attgcccggt ggtcgccgcc ggcgcgggcg aggactacca gaaatatgcc      1500
     cgcctcaagg gcttcaccct gcaagcggcg gcggacgtct ccttccgcgg cacgccggat      1560
     tcgctgccgg acgtgccggt ggtcacggcg gtggtggccg gcaagtcgct ggtggcgcgc      1620
     cagcccgaga gcctcgccgg gccgctcgcc tgtccggcgg cgggcaagat tccggccgat      1680
     ctcgtcaccg cggcggccgg gctgatcggc aagccgcagc ttcccgtgcc cggcggcgcc      1740
     ggcggcggct acgcccgcga actggtgacg aaaaacccga aggcgcgccc cgccgacatc      1800
     gccaacgcgc tgatcctctc ctattgcggg ctcgtcgccg ccgacaaggg catcgagccg      1860
     gcgacccagc acgcctatgt cgaggatttc ggccagcagg tgatccagac gctgcaggtc      1920
     cagccctga                                                              1929
//

If you have problems or comments...

PBIL Back to PBIL home page