(data stored in ACNUC1104 zone)

EMBL: CP002026.PE305

CP002026.PE305       Location/Qualifiers
FT   CDS_pept        303590..304453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0308"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: oan:Oant_2567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87642"
FT                   /db_xref="GOA:D7A226"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D7A226"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADH87642.1"
FT                   /translation="MSLRSLGSMLLLAVMWGLSIPVTKMGLETLPPLTLTALRFAVAVP
FT                   LLFALLAGRWRLPWRAVPKVAALGFLAIGIGQVTQTLGVVGTSASVGTVITATIPLFIV
FT                   VIAALRLRQPVTLLQTAGLIAAFAGIALVAFGDRDPAALAQTTASGAILMLLSAAAIAF
FT                   YYVWSVEVADAYGTVTVVAWSTLCGFISLAPWAAWEASNTPFVIGVTAIGAAIYLGVVV
FT                   TVAGLFLWLNMLRTVPARVAASVQFLQPVVGVMASAALFGDHLGLAFFVGVALVLTGLA
FT                   TTLANR"
     atgtctcttc ggagcctggg ctccatgctg ctcctggccg tgatgtgggg cctttccata        60
     cccgtcacca agatgggact ggagacgctt ccgcctttga cgctcaccgc gcttcgcttc       120
     gcggtcgcgg tgccgctgct gttcgctctc ctggcgggaa ggtggcggct gccttggcgg       180
     gccgtgccca aggtggcggc gctcggcttc ctggcgatcg gcatcggaca ggtcacccag       240
     actctcggag tggtggggac ctcggcctcg gtcggcacgg tgatcaccgc taccattccg       300
     ctgttcatcg tggtcatcgc cgcgctgcgc ttgcggcagc cggtcacgct tctccagaca       360
     gccggcctga tcgcggcgtt tgccggcatc gccctggtcg cgttcggcga cagggacccc       420
     gcggccctgg cccagacgac ggcgagtggc gcaatcctta tgctgctctc cgctgcggcc       480
     atcgccttct actatgtgtg gagcgtcgag gtcgccgatg cctatggcac ggtgaccgtc       540
     gtggcgtgga gcaccctctg cggctttatc agcctcgcgc catgggccgc gtgggaagcg       600
     tcgaataccc cgttcgtcat cggcgtcacg gcgatcggcg ccgcgatcta tctgggcgtt       660
     gtcgtcaccg tggcgggcct gttcctctgg ctgaacatgc tccgcaccgt gcccgcccgt       720
     gtggccgcca gcgttcagtt cctgcagcct gtcgtcgggg tcatggcctc cgccgccctg       780
     ttcggcgacc atctcggcct ggcgttcttc gtcggcgtcg ctttggtcct gacaggactg       840
     gcgacgacgc tggccaacag gtga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page