(data stored in ACNUC1104 zone)

EMBL: CP002026.PE307

CP002026.PE307       Location/Qualifiers
FT   CDS_pept        complement(306099..306905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0310"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="TIGRFAM: undecaprenol kinase; KEGG: xau:Xaut_1807
FT                   putative undecaprenol kinase; PFAM: Bacitracin resistance
FT                   protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87644"
FT                   /db_xref="GOA:D7A228"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D7A228"
FT                   /inference="protein motif:TFAM:TIGR00753"
FT                   /protein_id="ADH87644.1"
FT                   /translation="MSFGTLLEAFLLGLLEGFTEFLPVSSTGHILLAGHFLGFESQGKV
FT                   FEVVIQLGAILAIVVAYFQRFLHVLVTLPTSERSRNFVIGILIAFLPAAVIGAFAHGFI
FT                   KNVLFETPALICIMLILGGGVLLWVDTLKLRPIHDDAMAFPKALALKIGFIQCLAMIPG
FT                   VSRSGSTIVGGLLLGASKPAAAEFSFFLALPTMAGAFAYDLYKNRDALNADDATLIAVG
FT                   FVAAFIAALAVVRGLIAFVSRHGYTPFGWWRIAVGGVGLVALALVG"
     atgtcgttcg gcaccctgct cgaagccttc ctcctcggcc tcctggaagg cttcaccgag        60
     ttcctgccgg tctcctcgac cggccacata ttgctcgccg gacatttcct cggcttcgaa       120
     agccagggca aggtgttcga ggtggtgatc cagctcggcg ccatcctcgc catcgtcgtc       180
     gcctatttcc agcgcttcct gcatgtgctc gtcacgctgc cgaccagcga gcgctcgcgc       240
     aacttcgtca tcggcatcct catcgccttc ctgccggcgg cggtgatcgg ggcgttcgcg       300
     cacggcttca tcaagaacgt gctgttcgag acgccggcgc tgatctgcat catgctcatc       360
     ctaggcggcg gcgtgctgct ctgggtcgac acgctgaagc tgcggccgat ccacgacgat       420
     gccatggcct tcccgaaggc gctggcgctg aagatcggtt tcatccagtg cctcgccatg       480
     atccccggcg tgtcgcgctc gggctcgacc atcgtcggcg ggctgctgct cggcgccagc       540
     aagccggcgg cggccgagtt ctccttcttc ctcgccttgc cgaccatggc cggcgccttc       600
     gcctacgacc tctacaagaa ccgcgacgcg ctgaacgccg acgacgcaac gctgatcgcg       660
     gtgggcttcg tcgccgcctt catcgccgcg ctggcggtgg tgcgcgggct catcgccttc       720
     gtctcccgcc acggctacac gcccttcggc tggtggcgca tcgcggtggg cggcgtcggg       780
     ctggtggcgc tggcgctggt gggctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page