(data stored in ACNUC1104 zone)

EMBL: CP002026.PE311

CP002026.PE311       Location/Qualifiers
FT   CDS_pept        309159..310262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0314"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; KEGG: azc:AZC_4449 phenylalanyl-tRNA synthetase
FT                   alpha subunit; PFAM: phenylalanyl-tRNA synthetase class
FT                   IIc; aminoacyl tRNA synthetase class II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87648"
FT                   /db_xref="GOA:D7A232"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:D7A232"
FT                   /inference="protein motif:TFAM:TIGR00468"
FT                   /protein_id="ADH87648.1"
FT                   /translation="MSVAAALPDLDALERELSSAITAAADEAGLEAVRVSALGKKGSVS
FT                   ELLKSLGGMSPEERKTAGPAINGLRDRLNEALGARRTELKAAALTKRLETERVDVTLPV
FT                   RETPAELGRVHPISQVIDELTAIFADMGFSVAEGPDIEDDFHNFTALNFPEGHPAREMH
FT                   DTFYLPTKEDGSRLVLRTHTSPVQVRTMLSKKPPIRVICPGRTYRSDSDQTHTPMFHQV
FT                   EGLVIDKGSNLGHLKWILEEFCKAFFEVDNVKMRFRPSFFPFTEPSMEVDIQCDRSRPG
FT                   EIRFGEGSDWLEILGCGMVHPNVLKNCGLDPDEYQGFAWGMGIDRIAMLKYGMPDLRAF
FT                   FEADVRWLSHYGFRPLDFPTLAGGLSN"
     atgtccgtcg ccgccgccct tcccgatctc gacgcgctgg agcgcgagct ctcttccgcc        60
     atcactgccg ccgccgacga ggcggggctg gaggcggtgc gcgttagcgc actgggcaag       120
     aagggctcgg tctccgagct cctgaagagc ctcggcggca tgagcccgga ggagcgcaag       180
     accgccggcc cggccatcaa cggcctgcgc gaccggctca acgaggcgct cggcgcccgc       240
     cgcaccgagc tgaaggcggc ggcgctcacc aagcggctgg agaccgagcg cgtcgacgtc       300
     acgctccccg tgcgcgagac cccggccgag ctcggccgcg tccatccgat cagccaggtg       360
     atcgacgagc tcaccgccat cttcgccgac atgggcttct cggtggcgga aggcccggac       420
     atcgaggacg acttccacaa cttcaccgcg ctgaacttcc ccgaggggca tccggcgcgc       480
     gagatgcacg acaccttcta cctgcccacc aaggaggacg gctcgcggct cgtgctgcgc       540
     acccacacct cgccggtgca ggtgcgcacc atgctgtcca agaagccgcc catccgcgtc       600
     atctgccccg gccgcaccta tcgctcggac agcgaccaga cccacacgcc gatgttccat       660
     caggtggagg ggctggtcat cgacaagggc tccaatctcg ggcacctgaa gtggatcctc       720
     gaggagttct gcaaggcctt cttcgaggtc gacaatgtga agatgcggtt ccgcccgtcc       780
     ttcttcccct tcaccgagcc gtccatggag gtcgacatcc agtgcgaccg ctcgcggccg       840
     ggcgagatcc gcttcggcga gggctcggac tggctggaga tcctcggctg cggcatggtg       900
     cacccgaacg tgctgaagaa ttgcggcctc gacccggacg agtatcaggg cttcgcctgg       960
     ggcatgggga tcgaccgcat cgccatgctg aaatacggca tgccggacct gcgcgccttc      1020
     ttcgaggcgg atgtccgctg gctctcccat tacggcttcc gcccgctcga cttcccgacg      1080
     ctggccggcg gcctgtcgaa ctga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page