(data stored in ACNUC1104 zone)

EMBL: CP002026.PE312

CP002026.PE312       Location/Qualifiers
FT   CDS_pept        310282..312687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0315"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: azc:AZC_4450 phenylalanyl-tRNA synthetase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87649"
FT                   /db_xref="GOA:D7A233"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D7A233"
FT                   /inference="protein motif:TFAM:TIGR00472"
FT                   /protein_id="ADH87649.1"
FT                   /translation="MKFTLSWLREHLSGDYSLDDVTGTLNRIGFEVEGVEDKAAKLKGF
FT                   SIAYVVSAVQHPNADKLRVCMVDTGQGEPVQVVCGAPNARTGMKSVFSPPGTYIPGKDI
FT                   TLGIGTIRGVESRGMLCSAAELELSEDHDGIIDLPADAPVGATYVDWAGLGDPVVEIAV
FT                   TPNRADGLGIHGIARDLAAAGVGTLIEKPIEAVKGAYPCPVSVIIAEGAPCPAFALRLV
FT                   RGVKNGPSPDWLQAKLRAIGLRPINTLVDITNFLTFDQNRPLHVFDAAKVHGNLVVRRA
FT                   KEGESLPALDGKTYALDESMCVIADDRAVESLAGVMGGEESGCDETTVDVLVESALWEP
FT                   INIAQTGRKLGLNSDARFRFERGIDPAFTLPGLEMATKLILDLCGGEASEVVLAGAIPD
FT                   TTRVIEFPLSLTEKLTGLVASDSEQVETLGKLGFKVEGTSGTARVTPPSWRGDIEGKAD
FT                   LVEEVVRIAGLDRVPSIPFPRDETARKPVLTTLQLRTRKAKRALAARGLVEAVTWSFVA
FT                   KEQAELFGGGAPELALANPIASDLSDMRPSLLPGLIGSAQANADRGHGDSALFEVGQVF
FT                   KGDRPQDQFIAATGIRRATARPMGAGRHWSAKAGAVDAFDAKADALAVLAAAGAPVANL
FT                   QISTDAPAWFHPGRSGTFRLGPNVIGHFGELHPSVLEALDADGPLVGFEVLIDRIPEPK
FT                   AKATRVKPLLELAAFQPVERDFAFVVPRSVAAGDMVKAAAGVDRKLITAVNVFDLYEGA
FT                   GIDEDKKSVALSVTLQPREKTLTDAEIEAVAGKIVAEVAKKTGAMLRG"
     atgaaattca ccctctcctg gctgcgcgag cacctttccg gcgactattc gctcgacgac        60
     gtgaccggca cgctcaaccg catcggcttc gaggtcgagg gcgtcgagga caaggcggcc       120
     aagctcaagg gcttctccat cgcctatgtc gtctccgccg tgcagcaccc gaacgccgac       180
     aagctgcgcg tctgcatggt cgacaccggg cagggcgagc cggtgcaggt ggtgtgcggc       240
     gcgccgaacg cgcgcaccgg catgaagagc gtgttctcgc cgcccggcac ctacatcccc       300
     ggcaaggaca tcacgctcgg catcggcacc atacgcggcg tcgagagccg gggaatgctg       360
     tgctcggcgg ccgagctcga gctctccgag gaccatgacg gcatcatcga ccttccggcc       420
     gacgcgccgg tcggggcgac ctatgtcgac tgggcgggcc ttggcgaccc ggtggtggag       480
     atcgccgtca ccccgaaccg cgccgacggg ctcggcattc acggcatcgc ccgcgacctc       540
     gccgccgccg gtgtcggcac gctgatcgaa aagccgatcg aggccgtgaa gggcgcctat       600
     ccgtgcccgg tctcggtgat catcgccgag ggcgcgccgt gcccggcctt cgcgctgcgc       660
     ctcgtccgcg gggtgaagaa cggcccgtcg cccgactggc tgcaggcgaa gctgcgcgcc       720
     atcgggctgc gcccgatcaa cacgctggtc gacatcacca atttcctgac cttcgaccag       780
     aaccgcccgc tgcacgtctt cgacgccgcg aaggtccacg gcaatcttgt cgtgcgccgc       840
     gccaaggagg gcgagagcct gccggcgctc gatggcaaga cctatgcgct tgacgagagc       900
     atgtgcgtca tcgccgacga ccgcgccgtg gaatcgctcg ccggcgtgat gggcggcgag       960
     gaatcgggct gcgacgagac gaccgtcgac gtgctggtcg aatccgcgct gtgggagccg      1020
     atcaacatcg cccagaccgg ccgcaagctc gggctgaatt ccgacgcccg cttccgtttc      1080
     gagcgcggca tcgacccggc cttcaccctg ccggggctgg agatggcgac gaagctgatc      1140
     ctcgacctct gcggcggcga agcgtccgag gtcgtgctgg ccggcgccat ccccgacacc      1200
     acgcgggtga tcgagttccc gctgagcctc accgagaagc tgacgggctt ggtcgccagc      1260
     gattccgagc aggtcgagac gctcggcaag ctcggcttca aggtcgaggg cacttcgggc      1320
     accgcgcgcg tcactccgcc gtcctggcgc ggcgacatcg agggcaaggc cgacctcgtc      1380
     gaggaagtcg tgcgcatcgc cggcctcgac cgcgtgccgt ccattccctt cccgcgcgac      1440
     gagaccgccc gcaagcctgt gctgaccacg ctgcagctgc gcacccgcaa ggccaagcgc      1500
     gcgctcgccg cccgcgggct ggtcgaggcg gtcacctggt ccttcgtggc caaggagcag      1560
     gccgagctgt ttggcggcgg cgcgccggag ctggcgctcg ccaaccccat cgcctccgat      1620
     ctctccgaca tgcgccccag cctgctgccg ggcttgattg gttcggcgca ggccaatgcc      1680
     gaccgcggcc atggcgacag cgcgctgttc gaggtggggc aggtgttcaa gggcgaccgg      1740
     ccgcaggacc agttcatcgc tgccaccggc atccgccgcg ccaccgccag gcctatgggc      1800
     gccggccgcc attggtcggc caaggccggg gcggtcgatg ccttcgacgc caaggcggat      1860
     gcgctggcgg tgctggcggc ggcgggcgcg ccagtggcga atttgcagat ctcgaccgac      1920
     gccccggcgt ggttccatcc cggccgctcc ggcaccttcc ggctcggccc gaacgtcatc      1980
     ggccatttcg gcgaactgca cccttcggtg ctggaggcgc tcgacgccga cggcccgctg      2040
     gtcggcttcg aagtcctgat cgaccgcatc cccgagccga aggccaaggc gacgcgcgtc      2100
     aagccgctct tggagctcgc ggccttccag ccggtcgagc gcgacttcgc cttcgtggtg      2160
     ccgcgctcgg tcgcggcggg cgacatggtg aaggcggcgg ccggcgtcga ccgcaagctg      2220
     atcaccgcgg tgaacgtgtt cgacctctat gagggagcgg gcatcgacga ggacaagaag      2280
     tcggtggcgc tctccgtcac gctccagccg cgcgagaaga ccctgaccga cgccgagatc      2340
     gaggcggtgg cgggcaagat cgtcgcggaa gtggcgaaga agaccggcgc gatgctgcgg      2400
     gggtag                                                                 2406
//

If you have problems or comments...

PBIL Back to PBIL home page