(data stored in ACNUC1104 zone)

EMBL: CP002026.PE314

CP002026.PE314       Location/Qualifiers
FT   CDS_pept        complement(314243..314851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0317"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rec:RHECIAT_CH0002605 probable amino acid efflux protein,
FT                   LysE family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87651"
FT                   /db_xref="GOA:D7A235"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D7A235"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADH87651.1"
FT                   /translation="MPLSAYIAGLASGLSLIVAIGAQNAFVLQRGLRGEHVFAVCLACA
FT                   LSDAVLIAAGVAGLQQMLAMAPWLDAALRYAGAAFLVWYGARSLRSALRSQEALVVGAG
FT                   GAAALGPTLAATLALTWLNPHVYLDTMVLLGTLSTRHPGAEAFFAFGAITGSFAFFFGL
FT                   GYGAAWLRPLFARPSSWRVLEGVIAAVMWSIALGLLMDR"
     atgccccttt ccgcctatat cgccggcctc gcctcgggcc tcagcctcat cgtcgccatc        60
     ggcgcgcaga acgccttcgt gcttcagcgc ggattgcgcg gcgagcacgt cttcgccgtc       120
     tgcctcgcct gcgcgctgtc cgacgcggtg ctgatcgccg ccggcgtcgc cggcctgcag       180
     cagatgctgg ccatggcgcc ctggctcgat gcggcgctgc gctatgccgg cgcggccttc       240
     ctcgtctggt acggcgcacg cagcctgcgc tcggcgctgc gctcgcagga ggcgctggtg       300
     gtcggcgccg gtggcgccgc ggcgctcggg ccgacgctcg ccgcgacgct cgcgctcacc       360
     tggctcaacc cgcatgtcta tctcgacacc atggtgctgc tcggcacgct ctccacccgc       420
     catcccggcg ccgaggcgtt cttcgctttt ggtgccatca ccggctcctt cgccttcttc       480
     ttcggcctcg gctatggcgc ggcgtggctg cggccgctct tcgcccgccc ctcctcctgg       540
     cgggtgctgg aaggcgtgat cgccgccgta atgtggagca tcgccctcgg cctgctcatg       600
     gacaggtga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page