(data stored in ACNUC1104 zone)

EMBL: CP002026.PE315

CP002026.PE315       Location/Qualifiers
FT   CDS_pept        314941..315837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0318"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="KEGG: rhi:NGR_b00130 transcriptional regulator, LysR
FT                   family; TIGRFAM: transcriptional regulator, ArgP family;
FT                   PFAM: regulatory protein LysR; LysR substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87652"
FT                   /db_xref="GOA:D7A236"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7A236"
FT                   /inference="protein motif:TFAM:TIGR03298"
FT                   /protein_id="ADH87652.1"
FT                   /translation="MLDYSALRAVAAVVQAGSFEKAARTLNVTPSAVSQRVKQLEERLG
FT                   TVLIARGTPCTATEIGAKLCRHMEHVGMLEGELLAGLPALADASPRQRVTVHIAVNADS
FT                   LGTWFVEAIAAFARRSDYLVGLVVDDQDHTAEWLKAGRVVAAVTSLEKPIQGCRRLSLG
FT                   ALRYHATASPDYRARHFPDGVTPAAIANAPALTFDQKDQLQSRWIRQALGADIAHPTHW
FT                   LPSPQSFIEATLAGMGWGMNPFRSVRDHLAAGRLVELIPDTPVDTPLFWQVNRLVAERL
FT                   ADLTREVTAVARRELAG"
     atgctcgatt attccgcgct ccgcgccgtg gcggcggtgg tgcaggccgg cagcttcgag        60
     aaggcggccc gcacgctcaa cgtcacgccg tcggccgtct cgcagcgggt gaagcagctc       120
     gaggagcggc tgggcaccgt attgatcgcc cgcggcacgc cctgcaccgc gaccgagatc       180
     ggcgcgaagc tgtgccggca catggagcat gtcggcatgc tggagggcga attgctcgcc       240
     ggcctgccgg cgctggccga tgcctcgccg cgccagcgcg tcaccgtgca tatcgcggtg       300
     aacgccgaca gcctcggcac ctggttcgtg gaggccatcg ccgccttcgc ccgccgctcg       360
     gactatctcg tcggcctcgt cgttgacgac caggaccaca ccgccgaatg gctcaaagcc       420
     gggcgggtgg tggccgcggt caccagcctg gagaagccga tccagggctg ccggcggctc       480
     tcgctcggcg cgctgcgcta ccacgcgacg gcgagcccgg actacagggc gcggcatttc       540
     cccgacggcg tgaccccggc tgccatcgcg aatgcgccgg cgctgacctt cgaccagaag       600
     gaccagctgc agagccggtg gatccggcag gcgctggggg cggatatcgc ccatcccacc       660
     cattggctgc cctcgccgca gagcttcatc gaggcgaccc ttgccggcat gggctggggc       720
     atgaacccgt tccgctcggt gcgagatcat ctcgccgccg ggcggctcgt cgagctgatc       780
     ccggacacgc cggtcgacac gccgctgttc tggcaggtga accggctggt ggccgagcgg       840
     ctggccgatc tgacacgcga agtgacggcc gtggcccggc gcgaactcgc cggctaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page