(data stored in ACNUC1104 zone)

EMBL: CP002026.PE316

CP002026.PE316       Location/Qualifiers
FT   CDS_pept        316018..316680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0319"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   xau:Xaut_1152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87653"
FT                   /db_xref="GOA:D7A237"
FT                   /db_xref="UniProtKB/TrEMBL:D7A237"
FT                   /inference="protein motif:PFAM:PF04401"
FT                   /protein_id="ADH87653.1"
FT                   /translation="MLRDAFAAFAETFSPDYRRVLLRSVGFAVGLLVALGIGAHYALTY
FT                   FVALDLRWAEITLDIVAAFGIFIAAIFLVPPVTSLIAGLFLDDVAAQVERGFPGEPEGQ
FT                   PLPIGRSLFLTVKFFGVMLAVNLVALLLLLVPGVNLVVFYVANGYLLGREYFQLAAMRY
FT                   RDEDEVALLRRHHAGAIFLAGLIIAAVVSVPILNLVTPVFATIFMVRLHKRLSRREY"
     atgctgcggg atgcgtttgc cgccttcgcc gagaccttct cgccggacta tcgccgggtg        60
     ctgctgcgct cggtcggctt cgccgtcggc ctgctcgtcg cgctcggcat cggcgcgcat       120
     tacgcgctga cctatttcgt cgcgctggac ctgcgctggg ccgagatcac gctcgacatc       180
     gtcgccgcct tcggcatctt catcgccgcc atcttcctgg tgccaccggt gacctcgctg       240
     atcgccggcc tgttcctcga cgacgtcgcc gcgcaggtcg agcggggctt ccccggcgag       300
     cccgagggcc agccgctgcc gatcggccgc tcgctcttcc tcacggtgaa gttcttcggc       360
     gtgatgctgg cggtgaacct cgtggcgctg ctgctgctgc tcgtgccggg ggtgaacctc       420
     gtcgtgttct acgtcgccaa cggctatctg ctcggacggg aatatttcca actcgccgcc       480
     atgcgctacc gcgacgagga cgaggtcgcg ctgctgcgcc gccaccatgc gggggcgatc       540
     ttcctcgccg ggctgatcat cgccgcggta gtgtcggtgc cgatcctcaa cctcgtcacc       600
     ccggtcttcg ccaccatctt catggtgcgg ctgcacaagc gcctgtcgcg tcgggaatat       660
     tag                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page