(data stored in ACNUC1104 zone)

EMBL: CP002026.PE318

CP002026.PE318       Location/Qualifiers
FT   CDS_pept        317551..318081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0321"
FT                   /product="Protein of unknown function DUF2244,
FT                   transmembrane"
FT                   /note="PFAM: Protein of unknown function DUF2244,
FT                   transmembrane; KEGG: azc:AZC_3683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87655"
FT                   /db_xref="GOA:D7A239"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:D7A239"
FT                   /inference="protein motif:PFAM:PF10003"
FT                   /protein_id="ADH87655.1"
FT                   /translation="MNAASTNQALGPTIDDEPTLFAARYQPYRSLGQHGFLVVMIIVAG
FT                   ISFVCGTAFLLMGAWPVFGMFGLDALAIYWAFRLNFRQARACEEIVVTPSLIRLRHVAA
FT                   DGTVYEEELNPLWTRLHRELHEDYGLQRLTLEMRGRPYVIGGFLHTAQREELAEQLSRA
FT                   LAEARRGVVRSTF"
     atgaacgctg ccagtaccaa ccaagctttg ggtccgacca tcgacgacga gccgacgctg        60
     ttcgcggcgc gctaccagcc ctatcgctcg ctcggccagc atggcttcct cgtcgtgatg       120
     atcatcgtcg ccggcatcag cttcgtctgc ggcacggcct tcctcctgat gggcgcctgg       180
     ccggtgttcg gcatgttcgg gctcgacgcg ctcgccatct actgggcgtt ccggttgaat       240
     ttccgccagg cgcgggcctg cgaggagatc gttgtcacgc cgagcctgat ccggctgcgc       300
     cacgtcgcgg cggacggcac ggtctatgag gaggagctca atccgctctg gacgcggctc       360
     caccgggaac tgcacgagga ttacggcctg cagcgcctga cgctggagat gcgcggccgg       420
     ccctatgtca tcggcggctt cctgcacacc gcgcagcgcg aggaactggc cgagcagctc       480
     tcacgggcgc tcgccgaggc ccggcgcggc gtggtgcgct cgacgtttta g                531
//

If you have problems or comments...

PBIL Back to PBIL home page