(data stored in ACNUC1104 zone)

EMBL: CP002026.PE319

CP002026.PE319       Location/Qualifiers
FT   CDS_pept        318210..319088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0322"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; helix-turn-helix- domain
FT                   containing protein AraC type; KEGG: xau:Xaut_2813
FT                   methylated-DNA--protein-cysteine methyltransferase; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87656"
FT                   /db_xref="GOA:D7A240"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D7A240"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADH87656.1"
FT                   /translation="MLAPNLDAAHPLEIAAHDYEIVRRAVEYVNLRFRDQPEVEEIARA
FT                   AGVNPRALTDLFRRWCGLTPKDFLQAVTIDAARRVLTESDNVLDAAYELGLSGPGRLHD
FT                   LFIVHESMSPGEWKTGGAGLVVRYGFHASQFGMALAMVTPRGLCGLAFADEGEEDKALA
FT                   DMRRRWPNALYIEDPIATAPYAARIFDSQKWSLDDPLRIVFIGTDFEVRVWETLMRIPL
FT                   GKATTYSNIASCVERPSAARAVGAAIGKNPMSFVVPCHRVLGKNGDLTGYHWGLTRKRA
FT                   ILGWEAGQLCK"
     gtgcttgctc ccaatctcga cgccgcccac ccgctggaaa tcgccgccca cgactacgag        60
     atcgtgcggc gtgcggtcga atatgtgaac ctgcgcttcc gcgaccagcc ggaggtggag       120
     gagatcgccc gcgccgcggg ggtcaacccg cgcgcgctca ccgacctgtt ccgccgctgg       180
     tgcggcctca ccccgaagga cttccttcag gcggtgacca tcgacgcggc gcggcgggtg       240
     ctgaccgaat ccgacaatgt gctcgacgcc gcctatgagc tcggcctctc cggccccggc       300
     cggctgcacg acctgttcat cgtgcacgaa tccatgtcgc cgggcgaatg gaagaccggc       360
     ggcgccggcc tcgtggtgcg ctacggcttc cacgcctcgc aattcggcat ggcgctcgcc       420
     atggtgacgc cgcgcggcct gtgcggcctc gccttcgccg acgagggcga ggaggacaag       480
     gcgctcgccg atatgcgccg gcgctggccg aacgccctct acatcgagga cccgatcgcc       540
     accgcgccct acgcggcgcg catcttcgat tcgcagaaat ggagcctcga cgatccgctg       600
     cgcatcgtct tcatcggcac cgatttcgag gtgcgggtgt gggagacgct gatgcgaatt       660
     ccgctcggca aggcgaccac ctattccaac atcgccagct gcgtcgagcg gccgagcgcc       720
     gcgcgcgcgg tcggcgcggc gatcggcaag aacccgatgt ccttcgtcgt gccctgccac       780
     cgcgttctcg gcaagaacgg cgacctcacc ggctatcact ggggtctcac ccgcaagcgg       840
     gcgatactcg gctgggaggc gggccagctc tgcaaatag                              879
//

If you have problems or comments...

PBIL Back to PBIL home page