(data stored in ACNUC1104 zone)

EMBL: CP002026.PE320

CP002026.PE320       Location/Qualifiers
FT   CDS_pept        complement(319110..319550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0323"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   mrd:Mrad2831_5841 transmembrane pair domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87657"
FT                   /db_xref="GOA:D7A241"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:D7A241"
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /protein_id="ADH87657.1"
FT                   /translation="MRTPADRIRHVVIFEIIALSIITPLGAWVFGLPMTEMGVVGAGAA
FT                   LIAASWNYLFNLGFDHALARLRGSVRKTLGLRVVHALLFEAGLLAVLVPFIAWYLRIGL
FT                   VEAFLMDVALAGFFLIYAFLFNWAYDVIFPVRETRRRPVPAE"
     atgcgtaccc ccgccgaccg catccgccac gtcgtcatct tcgagatcat cgccctgtcg        60
     atcatcacgc ccctcggggc gtgggtgttc ggcctgccga tgacggagat gggcgtggtc       120
     ggcgccggcg ccgccctcat cgccgccagc tggaactacc tgttcaatct cggcttcgac       180
     cacgcgctgg cgcggctgcg cggctcggtg cgcaagaccc tcgggctgcg cgtcgttcac       240
     gcgctgttgt tcgaggccgg cctgctggcg gtgctggtgc cgttcatcgc ctggtatctg       300
     cgcatcggcc tcgtcgaggc gttcctcatg gacgtcgccc tggcgggctt cttcctgatc       360
     tacgccttcc tgttcaactg ggcctatgac gtgatcttcc cggtgcgcga gacgcgccgc       420
     cggccggtgc cggcggagta g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page