(data stored in ACNUC1104 zone)

EMBL: CP002026.PE322

CP002026.PE322       Location/Qualifiers
FT   CDS_pept        complement(320311..321126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0325"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="TIGRFAM: dihydrodipicolinate reductase; KEGG:
FT                   mpo:Mpop_2435 dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87659"
FT                   /db_xref="GOA:D7A243"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7A243"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ADH87659.1"
FT                   /translation="MTQMRLVVVGASGRMGRVLIRAVDEAPDLLLVGAIDQPGSEFIGR
FT                   DAGELAGLPPLGVKISDDALTHFAAADGVIDFTVPQATVGYAALAAQARIVHVIGTTGF
FT                   SPEDEEKIAAASRHAAIVKSGNMSLGVNLLAALVRRVARTLDEGFDIEVLEMHHNRKID
FT                   APSGTALLLGQAAAQGRGVTLEENGVFTRHGHTGARKAGDIGFATLRGGSVVGEHNVIF
FT                   AGQAERIELAHKAEDRGIFARGALAAARWARGRKPGLYSMADVLGLADF"
     atgacgcaga tgcggctcgt cgtcgtcggg gcttcgggac ggatgggtcg ggtgttgatc        60
     cgcgccgtcg acgaggctcc ggacctgctt ctcgtcggcg ccatcgacca gcccggcagc       120
     gagttcatcg gccgcgacgc cggcgagctc gccggcctgc cgccgctcgg cgtcaagatc       180
     tcggacgacg cgctcaccca tttcgccgct gccgacgggg taatcgactt caccgtgccg       240
     caggcgacgg tgggctatgc cgcgctcgcc gcgcaggccc gcatcgtcca cgtcatcggc       300
     accaccggct tctcgcccga ggacgaggag aagatcgctg ccgcctcgcg tcatgccgcc       360
     atcgtcaagt ccggcaatat gagcctcggc gtgaacctgc tggcggcgct ggtgcggcgg       420
     gtggcgcgca cgctcgacga aggcttcgac atcgaggtgc tcgaaatgca ccacaaccgc       480
     aagatcgacg cgccatccgg cacggcgctg ctgctcggcc aggcggcggc gcaggggcgc       540
     ggcgtcacgc tggaggagaa cggcgtcttc acccgccacg gccacaccgg cgcgcgcaag       600
     gccggcgaca tcggcttcgc cacgctgcgc ggcggctcgg tggtcggcga gcacaacgtc       660
     atcttcgccg ggcaggccga gcgcatcgag ctcgcccaca aggccgagga ccggggcatc       720
     ttcgcccgtg gcgcgctcgc ggccgcccgc tgggcgcgcg ggcgcaagcc ggggctctat       780
     tccatggccg acgtgctcgg cctcgccgac ttctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page