(data stored in ACNUC1104 zone)

EMBL: CP002026.PE326

CP002026.PE326       Location/Qualifiers
FT   CDS_pept        324638..325300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0329"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mch:Mchl_0328
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87663"
FT                   /db_xref="GOA:D7A247"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:D7A247"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADH87663.1"
FT                   /translation="MTTPPDPAGETFTERQQAVLDTVLALMVEQGGDVTMTAVARRASC
FT                   SKESLYKWFGDRDGLLTATVRWQASKVRAGNYDRTRLDILALRDSLIRFAANWLGVISS
FT                   PTSVALNRFAISQAGTRGSNLGAIMLANGRFAIGERLKPLLDAGREAGLLDFDDTETAF
FT                   RTFIGLVGRDVQIRVLLGDRLSLSPSEIERDAARATDQFLTLCGTEKTGPGRNQTNA"
     atgacgacgc cacccgatcc agcgggcgag accttcaccg aacgccagca ggcggtgctc        60
     gacaccgtgc tggcgctgat ggtggagcag ggcggcgacg tcaccatgac cgccgtggcg       120
     cggcgcgcga gctgctccaa ggaaagcctc tacaaatggt tcggcgaccg tgacgggctg       180
     ctcaccgcca cggtgcgctg gcaggcctcc aaggtgcgcg ccggcaatta tgaccgcacc       240
     cggcttgaca tccttgcgct gcgggacagc ctgatccgct tcgccgccaa ctggctcggc       300
     gtgatctcca gcccgacctc ggtcgcgctg aaccgcttcg ccatcagcca ggccggcacg       360
     cgcggctcga acctcggcgc catcatgctg gcgaacgggc gcttcgccat aggcgagcgg       420
     ctgaaaccgc tgctcgacgc cggccgcgag gccgggctgc tcgatttcga cgacaccgag       480
     accgccttcc gcaccttcat cggcctcgtc ggccgcgacg tgcagatccg cgtgctgctg       540
     ggcgaccgcc tcagcctctc gcccagcgag atcgagcggg atgcggcccg cgcgaccgac       600
     cagtttctca ccctctgcgg cacggaaaag acgggtccgg gccggaacca gaccaacgcg       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page