(data stored in ACNUC1104 zone)

EMBL: CP002026.PE328

CP002026.PE328       Location/Qualifiers
FT   CDS_pept        complement(326703..327227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0331"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   azc:AZC_2367 uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87665"
FT                   /db_xref="GOA:D7A249"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D7A249"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADH87665.1"
FT                   /translation="MIELESYAREMLAFVEAHAHWAPYIAFALAFGESIAVLSLFFPAT
FT                   FVLIGLGPIIEAGGAPFAPVWAAAVAGASLGDALSYWIGRHFKDSARHIWPLRNYPEML
FT                   ARGERFFRSYGSWSVFIGRFFGPLRAVVPLVAGMFGMPHLIFQMANVTSAMVWAFLLLA
FT                   PGAAAVKLLGW"
     ttgatcgagc tggagagcta tgcccgcgag atgctcgcct tcgtcgaggc gcatgcacac        60
     tgggcgccct acattgcctt cgcgctggcc ttcggcgaat ccatcgccgt gctgtcgctg       120
     ttcttccccg ccaccttcgt gctgatcggg ctaggcccga tcatcgaggc cggcggcgcg       180
     cccttcgcgc cggtctgggc ggcggcggtc gccggagcgt cactgggcga cgcgttgtcc       240
     tactggatcg gccgccattt caaggacagc gcccgccata tctggccgct gcgcaactat       300
     ccggagatgc tggcgcgcgg cgagcgcttc ttccgcagct atggaagttg gagcgtcttc       360
     atcggccgct tcttcgggcc cttacgcgcc gtggtgccgc tggtcgccgg catgttcggc       420
     atgccgcacc tgatcttcca gatggcgaac gtcacctccg ccatggtctg ggccttcctc       480
     ctgctcgcgc ccggcgcggc ggcggtgaag ctgctagggt ggtga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page