(data stored in ACNUC1104 zone)

EMBL: CP002026.PE329

CP002026.PE329       Location/Qualifiers
FT   CDS_pept        complement(327235..328518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0332"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   xau:Xaut_1940 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87666"
FT                   /db_xref="GOA:D7A250"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7A250"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADH87666.1"
FT                   /translation="MAFDTDHPASWYAATAHHLSPFPPLAGTVRTDVCVIGGGYTGLSA
FT                   ALHLAEAGLSVALLEASRLGSGASGRNGGQIHSGQRRDQDWLEAHVGLDDAKALWRLAE
FT                   DAKALLHRLIARHMIDCDVKPGLIVADHKPSYVAHSHAYARKLNEVYGYPHAAPLTREE
FT                   LRELVGSDAYYGGMIDRGGGHLHPLNLALGLAKAAHTAGARLFEQSRALRINEAGDKVK
FT                   VSTPRGVVEADWVLECGDGLQDGLDKRVDTHVMPIANYIAATEPLGERGREIISNGAAV
FT                   ADSRFVVNYYRLSGDGRLLFGGGESYTRRLRPNPGEFVRPYMLKVFPQLADVRIDYGWG
FT                   GLLGITMTRMPFVRRLSPRVLTAAGYSGQGVMLAPYFGKILAEAVKGQLGRFDLLAGLP
FT                   VPPFPGGPLMRWPLLVAGMSYYALRDRL"
     atggcgttcg ataccgatca tcccgcaagc tggtacgccg cgacggcgca ccatctctcc        60
     cccttcccgc cgctggcggg tacggtccgc actgacgtct gcgtcatcgg cggcggctat       120
     accggcctct ccgccgcgct gcacctcgcc gaggccgggc tgtcggtggc gctgctggaa       180
     gcctcgcgcc tcggctccgg cgcctcgggc cgcaatggcg ggcagatcca ttccggccag       240
     cgccgcgacc aggactggct ggaggcgcat gtcgggctcg acgacgccaa ggcgctgtgg       300
     cggctggctg aggacgccaa ggcgctgctg caccggctca tcgcccgcca catgatcgat       360
     tgcgacgtga agccgggcct gatcgtcgcc gatcacaagc cctcctatgt cgcccacagc       420
     cacgcttatg cgcgcaagct caacgaggtc tacggctacc cgcacgcagc cccgctgacc       480
     cgcgaggagc tgcgcgagct ggtcggctcc gacgcctatt atggcggcat gatcgaccgc       540
     ggcggcggcc atctgcaccc gctcaacctc gcactgggcc tcgccaaggc cgcgcacacg       600
     gccggcgcgc ggctgttcga gcagtcgcgg gcgctgcgca tcaatgaggc cggcgacaag       660
     gtgaaggtct cgacgcctag gggcgtggtc gaggccgatt gggtgctcga atgcggcgac       720
     gggctgcagg acgggctcga caagcgcgtc gacacccatg tgatgccgat cgccaactac       780
     atcgccgcca ccgagccgct gggcgagcgg gggcgggaga tcatctcgaa tggcgcggcg       840
     gtggccgaca gccgcttcgt ggtgaactat tatcgcctct ccggcgacgg ccggctgctg       900
     ttcggcggcg gcgagagcta tacgcgccgg ctgcggccga accccggcga gttcgtgcgc       960
     ccctatatgc tcaaggtctt cccgcagctt gccgatgtgc gcatcgacta tggctggggc      1020
     gggctgctcg gcatcaccat gacccgcatg cccttcgtgc gccgcctgtc gccgcgcgtg      1080
     ctcaccgccg ccggctattc cggccagggc gtgatgctgg cgccgtattt cggcaagatc      1140
     ctcgccgagg cggtgaaggg ccagctcggc cgcttcgacc tgctggccgg cctgccggtg      1200
     ccgcccttcc ccggcggccc gctgatgcgc tggccgctgc tggtcgccgg catgagctat      1260
     tacgcgctgc gcgaccggct gtga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page