(data stored in ACNUC1104 zone)

EMBL: CP002026.PE33

CP002026.PE33        Location/Qualifiers
FT   CDS_pept        27003..27236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_0750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87370"
FT                   /db_xref="GOA:D6ZZV6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZZV6"
FT                   /inference="similar to AA sequence:KEGG:Rleg2_0750"
FT                   /protein_id="ADH87370.1"
FT                   /translation="MRLIPNWRKVLLRAWSVRLGLIAGLFEGLNVVLQITVDRLPDVSL
FT                   GLRLAAGGCACLALVSRFIAQPKTIGESHADH"
     atgcgcctca ttccgaactg gcggaaggtg ctgctgcgcg cgtggagcgt gcgcctcggc        60
     ctgatcgccg gccttttcga aggcctcaac gtcgtcctgc agatcaccgt cgaccggctg       120
     cccgacgtct ctctcggtct gcgcctcgcc gccggcgggt gcgcctgcct ggcgctggtg       180
     tcccgcttca tcgctcaacc caagaccatc ggagaatccc atgccgatca ctaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page