(data stored in ACNUC1104 zone)

EMBL: CP002026.PE330

CP002026.PE330       Location/Qualifiers
FT   CDS_pept        complement(328543..330378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snov_0333"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="KEGG: azc:AZC_2393 DNA mismatch repair protein;
FT                   TIGRFAM: DNA mismatch repair protein MutL; PFAM: MutL
FT                   dimerisation; DNA mismatch repair protein domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snov_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADH87667"
FT                   /db_xref="GOA:D7A251"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D7A251"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ADH87667.1"
FT                   /translation="MPLRLLPSTLVDRIAAGEVVERPAAALKEIVENALDAGATRIEVV
FT                   IDGGGRRLMRVTDDGCGMSADELALAVERHATSKLDTEDLLSIATLGFRGEALPSIGAV
FT                   ARLSITSRPRGSDTAHEIRVEGGAKSAVKPAALGFGTRVEVRDLFFATPARLKFLKSER
FT                   AETAAAVDAVKRLALARPDVGFILVTDDRPPVTWPARSADAAGRRARIADVLGHEVGAN
FT                   ALDIDGLREGARLSGLAGLPTYAKANSLSQYLFVNGRPVRDKVLIGAIRAAYADLLPSD
FT                   RHPVTALFLDLDPHEVDVNVHPAKTEVRFRDAGNVRALIVRTLTDALALGVPRTASTAA
FT                   EKLAQFARPEFRQGAGNPPRPGNYDWTRSWAAPDVAPREASPAGFREEAAGFDFGLGLA
FT                   LAPSADARANAAPPAPDLMERPLGAARAQLHETYIIAQTKDGVVVIDQHAAHERIVYEK
FT                   LKAAMERDGLARQMLLVPLVVELDPSDAARLAERAAALEKLGLVLEPFGPGAVLVREVP
FT                   SLLGDADVCALVTELAEHAAEWDDALPLERRLLHIAATMACHGSVRAGRRLRVEEMNAL
FT                   LREMEETPNAAQCNHGRPTFVTLALADIERLFARR"
     atgcccctgc gcctgctccc ctccaccctg gtcgaccgca tcgccgcggg cgaggtggtg        60
     gagcgtccgg cggcggcgct gaaggagatc gtcgagaacg cgctcgatgc cggcgccacc       120
     cgcatcgagg tggtgatcga cggcggcggc cgccggctga tgcgggtgac cgacgacggc       180
     tgcggcatga gcgcggacga gctggctctg gccgtcgagc gccacgccac ctccaagctc       240
     gacaccgagg acctcctttc cattgccacg ctcggctttc gcggcgaggc gctgccctcg       300
     atcggcgcgg tggcgcggtt gtccatcacc agccgcccgc gcggctccga caccgcgcat       360
     gagatccgcg tcgagggcgg ggcgaagtcg gcggtgaaac ccgccgctct cggtttcggc       420
     acccgtgtcg aggtccgcga cctgttcttc gccaccccgg cgcggctgaa attcctgaaa       480
     tccgagcgcg ccgagaccgc ggcggcggtg gatgcggtca agcgcctggc gctggcccgt       540
     cccgatgtcg gcttcatcct ggtcaccgat gaccgcccgc ccgtcacctg gccggcgcgc       600
     tccgccgatg cggccggccg gcgcgcccgc atcgccgacg tgctcggcca tgaggtcggc       660
     gccaatgcgc tcgacattga cggcctgcgc gaaggggcaa ggctctccgg cctcgctggg       720
     cttccgacct acgccaaggc caattcgctg tcgcagtacc tgttcgtcaa tggacggccg       780
     gtgcgcgaca aggtgctgat cggcgccatc cgcgccgcct atgccgacct gctgcccagc       840
     gaccgccacc cggtgacggc gctgttcctc gacctcgatc cgcacgaggt ggacgtgaac       900
     gtgcatccgg ccaagaccga ggtgcgcttc cgcgacgccg gcaatgtccg cgcgctgatc       960
     gtgcgcacgc tgaccgacgc cctggcgctc ggcgtgccgc gcaccgcctc gacggcggcg      1020
     gagaagctgg cgcagttcgc ccgccccgaa ttccggcaag gtgctggcaa tccgccgcgc      1080
     cccggcaact atgactggac ccgctcctgg gcggcgccgg acgtcgcccc gcgtgaggcc      1140
     tctcccgcgg gttttcgcga ggaggcggcg ggcttcgact tcgggctggg cctcgcgctc      1200
     gccccttcgg cggacgcccg cgccaatgcc gcgccgccgg cgccggacct gatggagcgc      1260
     ccgctgggcg ccgcccgcgc gcagttgcac gagacctaca tcatcgccca gacgaaggac      1320
     ggcgtggtcg tcatcgacca gcacgccgcg catgagcgca tcgtctacga gaagctgaag      1380
     gccgcgatgg agcgcgacgg cctcgcccgg cagatgctgc tggtgccgct cgtggtcgag      1440
     ctcgacccct ccgacgccgc ccgcctcgcc gagcgcgccg cggcgctgga aaagctcggc      1500
     ctcgtcctcg agcccttcgg ccccggcgcg gtgctggtgc gcgaggtgcc ctccctcctc      1560
     ggcgatgccg acgtctgcgc cctcgtcacc gagctcgccg agcacgccgc cgaatgggac      1620
     gacgcgctgc cgctggaacg gcgccttctg cacatcgccg ccaccatggc ctgccacggc      1680
     tcggtgcgcg ccggccggcg gctgcgcgtc gaggagatga acgccctgct gcgcgagatg      1740
     gaagagacgc ccaacgccgc gcagtgcaat catggccggc cgaccttcgt cacgctggcg      1800
     ctcgccgaca tcgaacgcct cttcgcgcgg cgatag                                1836
//

If you have problems or comments...

PBIL Back to PBIL home page